BLASTX nr result
ID: Aconitum21_contig00001730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00001730 (545 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514516.1| catalytic, putative [Ricinus communis] gi|22... 70 2e-10 ref|XP_002315969.1| predicted protein [Populus trichocarpa] gi|2... 69 6e-10 ref|XP_002277990.1| PREDICTED: probable isoprenylcysteine alpha-... 69 6e-10 emb|CAN79421.1| hypothetical protein VITISV_017373 [Vitis vinifera] 69 6e-10 ref|XP_003566932.1| PREDICTED: probable isoprenylcysteine alpha-... 68 1e-09 >ref|XP_002514516.1| catalytic, putative [Ricinus communis] gi|223546120|gb|EEF47622.1| catalytic, putative [Ricinus communis] Length = 445 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/75 (45%), Positives = 47/75 (62%) Frame = -1 Query: 233 AAAETXXXXXXXXXXXXXXXXXXXXIMRFATLGLYIILLMPGFLQVGYYYYASRKI*RSI 54 AAAET I+RF LG Y ++L+PGF+QVGYYY+ S+++ RSI Sbjct: 91 AAAETFLVTRLSLKLLTFLGVGYKWILRFMALGCYSVMLLPGFIQVGYYYFFSKQVLRSI 150 Query: 53 MHGEQPRNEIYLYLP 9 ++G+QPRN + LYLP Sbjct: 151 VYGDQPRNRLDLYLP 165 >ref|XP_002315969.1| predicted protein [Populus trichocarpa] gi|222865009|gb|EEF02140.1| predicted protein [Populus trichocarpa] Length = 517 Score = 68.6 bits (166), Expect = 6e-10 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -1 Query: 155 MRFATLGLYIILLMPGFLQVGYYYYASRKI*RSIMHGEQPRNEIYLYLP 9 MRF LG Y ++L PGF+QVGYYY+ S ++ RSI++G+QPRN + LYLP Sbjct: 189 MRFLALGCYSLMLFPGFIQVGYYYFFSGRVLRSIVYGDQPRNRLDLYLP 237 >ref|XP_002277990.1| PREDICTED: probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 [Vitis vinifera] gi|297737903|emb|CBI27104.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 68.6 bits (166), Expect = 6e-10 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -1 Query: 152 RFATLGLYIILLMPGFLQVGYYYYASRKI*RSIMHGEQPRNEIYLYLP 9 RF LG Y +LLMPGF+QVGYYY+ S ++ R I++G+QPRN + LYLP Sbjct: 131 RFLALGCYALLLMPGFIQVGYYYFFSSRVRRGIVYGDQPRNRLDLYLP 178 >emb|CAN79421.1| hypothetical protein VITISV_017373 [Vitis vinifera] Length = 395 Score = 68.6 bits (166), Expect = 6e-10 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -1 Query: 152 RFATLGLYIILLMPGFLQVGYYYYASRKI*RSIMHGEQPRNEIYLYLP 9 RF LG Y +LLMPGF+QVGYYY+ S ++ R I++G+QPRN + LYLP Sbjct: 115 RFLALGCYALLLMPGFIQVGYYYFFSSRVRRGIVYGDQPRNRLDLYLP 162 >ref|XP_003566932.1| PREDICTED: probable isoprenylcysteine alpha-carbonyl methylesterase ICME-like [Brachypodium distachyon] Length = 409 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -1 Query: 140 LGLYIILLMPGFLQVGYYYYASRKI*RSIMHGEQPRNEIYLYLPLD 3 L +Y ILLMPGFLQVGYYY+ S ++ RSI++GEQPRN + LY+P D Sbjct: 89 LAVYAILLMPGFLQVGYYYFFSSQVRRSIVYGEQPRNRLDLYIPKD 134