BLASTX nr result
ID: Aconitum21_contig00001684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00001684 (465 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O22642.3|CYC_FRIAG RecName: Full=Cytochrome c gi|2641197|gb|A... 115 3e-24 sp|P00067.1|CYC_TROMA RecName: Full=Cytochrome c 115 4e-24 dbj|BAJ95186.1| predicted protein [Hordeum vulgare subsp. vulgare] 115 4e-24 sp|P00068.1|CYC_WHEAT RecName: Full=Cytochrome c 115 4e-24 gb|AAC84135.1| cytochrome [Cichorium intybus] 115 5e-24 >sp|O22642.3|CYC_FRIAG RecName: Full=Cytochrome c gi|2641197|gb|AAB86850.1| cytochrome C [Fritillaria agrestis] Length = 113 Score = 115 bits (289), Expect = 3e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = -3 Query: 463 GYSYSAANKTKAVMWEDNTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTAS 284 GYSYSAANK KAV W++NTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLKE+T+S Sbjct: 54 GYSYSAANKNKAVNWDENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATSS 113 >sp|P00067.1|CYC_TROMA RecName: Full=Cytochrome c Length = 111 Score = 115 bits (288), Expect = 4e-24 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -3 Query: 463 GYSYSAANKTKAVMWEDNTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 287 GYSYSAANK KAV+W++ TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLKESTA Sbjct: 53 GYSYSAANKNKAVLWZZATLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 111 >dbj|BAJ95186.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 113 Score = 115 bits (288), Expect = 4e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = -3 Query: 463 GYSYSAANKTKAVMWEDNTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTAS 284 GYSYSAANK KAV WE+NTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLK++T+S Sbjct: 54 GYSYSAANKNKAVEWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKKATSS 113 >sp|P00068.1|CYC_WHEAT RecName: Full=Cytochrome c Length = 112 Score = 115 bits (288), Expect = 4e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = -3 Query: 463 GYSYSAANKTKAVMWEDNTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTAS 284 GYSYSAANK KAV WE+NTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI+YLK++T+S Sbjct: 53 GYSYSAANKNKAVEWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKKATSS 112 >gb|AAC84135.1| cytochrome [Cichorium intybus] Length = 112 Score = 115 bits (287), Expect = 5e-24 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -3 Query: 463 GYSYSAANKTKAVMWEDNTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLISYLKESTA 287 GYSYSAANK+KAV WE+NTLYDYLLNPKKYIPGTKMVFPGLKKPQ+RADLI+YLK STA Sbjct: 54 GYSYSAANKSKAVTWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKSSTA 112