BLASTX nr result
ID: Aconitum21_contig00000918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00000918 (505 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF06706.1| UP-9A [Nicotiana tabacum] 55 6e-06 >gb|ABF06706.1| UP-9A [Nicotiana tabacum] Length = 117 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 119 VLRRRNSELVRELNKSLEREEKMRAELDKTLRRLRIAE 232 +LRRRN EL +EL KS+EREEKM+ EL KT RLR+AE Sbjct: 27 ILRRRNEELEKELKKSIEREEKMKQELQKTWERLRVAE 64