BLASTX nr result
ID: Aconitum21_contig00000785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00000785 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509749.1| Osmotin precursor, putative [Ricinus communi... 213 1e-53 ref|XP_002509748.1| Osmotin precursor, putative [Ricinus communi... 211 4e-53 gb|AAK59275.1|AF378571_1 thaumatin-like protein [Sambucus nigra] 210 8e-53 emb|CAC22329.1| osmotin-like protein [Fagus sylvatica] 208 3e-52 sp|P13046.1|PRR1_TOBAC RecName: Full=Pathogenesis-related protei... 203 1e-50 >ref|XP_002509749.1| Osmotin precursor, putative [Ricinus communis] gi|223549648|gb|EEF51136.1| Osmotin precursor, putative [Ricinus communis] Length = 225 Score = 213 bits (542), Expect = 1e-53 Identities = 94/109 (86%), Positives = 97/109 (88%), Gaps = 1/109 (0%) Frame = -3 Query: 482 FFDISLVDGFNIPMDFSPT-GGCRGIRCTADINGQCPAQLRAPGGCNNPCTVFRTNEYCC 306 F DISLVDGFNIPMDFSPT G CRGIRC ADINGQCPAQL+APGGCNNPCTVF+TNEYCC Sbjct: 117 FIDISLVDGFNIPMDFSPTTGACRGIRCAADINGQCPAQLKAPGGCNNPCTVFKTNEYCC 176 Query: 305 TNGPGSCRPTEFSRFFKTRCPDAYSYPQDDPTSTFTCTSGGNYRVVFCP 159 TNG GSC PT FS+FFK RCPDAYSYPQDDPTSTFTC G NYRV FCP Sbjct: 177 TNGQGSCGPTTFSKFFKNRCPDAYSYPQDDPTSTFTCPGGTNYRVTFCP 225 >ref|XP_002509748.1| Osmotin precursor, putative [Ricinus communis] gi|223549647|gb|EEF51135.1| Osmotin precursor, putative [Ricinus communis] Length = 225 Score = 211 bits (538), Expect = 4e-53 Identities = 93/109 (85%), Positives = 98/109 (89%), Gaps = 1/109 (0%) Frame = -3 Query: 482 FFDISLVDGFNIPMDFSPT-GGCRGIRCTADINGQCPAQLRAPGGCNNPCTVFRTNEYCC 306 F DISLVDGFNIPMDFSPT G CRGIRC ADINGQCPA+L+APGGCNNPCTVF+TNEYCC Sbjct: 117 FIDISLVDGFNIPMDFSPTTGACRGIRCAADINGQCPAELKAPGGCNNPCTVFKTNEYCC 176 Query: 305 TNGPGSCRPTEFSRFFKTRCPDAYSYPQDDPTSTFTCTSGGNYRVVFCP 159 TNG GSC PT FS+FFK RCPDAYSYPQDDP+STFTC SG NYRV FCP Sbjct: 177 TNGQGSCGPTTFSKFFKDRCPDAYSYPQDDPSSTFTCPSGTNYRVTFCP 225 >gb|AAK59275.1|AF378571_1 thaumatin-like protein [Sambucus nigra] Length = 226 Score = 210 bits (535), Expect = 8e-53 Identities = 93/109 (85%), Positives = 98/109 (89%), Gaps = 1/109 (0%) Frame = -3 Query: 482 FFDISLVDGFNIPMDFSPTGGC-RGIRCTADINGQCPAQLRAPGGCNNPCTVFRTNEYCC 306 FFDISLVDGFN+ MDFSPTGGC RGI+CTADINGQCP +LRAPGGCNNPCTV+RTNEYCC Sbjct: 118 FFDISLVDGFNVAMDFSPTGGCARGIQCTADINGQCPNELRAPGGCNNPCTVYRTNEYCC 177 Query: 305 TNGPGSCRPTEFSRFFKTRCPDAYSYPQDDPTSTFTCTSGGNYRVVFCP 159 TNG G+C PT FSRFFK RC DAYSYPQDDPTSTFTC G NYRVVFCP Sbjct: 178 TNGQGTCGPTNFSRFFKERCRDAYSYPQDDPTSTFTCPGGTNYRVVFCP 226 >emb|CAC22329.1| osmotin-like protein [Fagus sylvatica] Length = 125 Score = 208 bits (530), Expect = 3e-52 Identities = 92/109 (84%), Positives = 96/109 (88%), Gaps = 1/109 (0%) Frame = -3 Query: 482 FFDISLVDGFNIPMDFSPTGG-CRGIRCTADINGQCPAQLRAPGGCNNPCTVFRTNEYCC 306 F DISLVDGFNIPMDFSPT G CRGI+CTADINGQCP +LR P GCNNPCTVF+TNEYCC Sbjct: 17 FIDISLVDGFNIPMDFSPTTGRCRGIKCTADINGQCPNELRVPSGCNNPCTVFKTNEYCC 76 Query: 305 TNGPGSCRPTEFSRFFKTRCPDAYSYPQDDPTSTFTCTSGGNYRVVFCP 159 TNG GSC PT FS+FFK RCPDAYSYPQDDPTSTFTC G NYRVVFCP Sbjct: 77 TNGQGSCGPTRFSKFFKQRCPDAYSYPQDDPTSTFTCPGGTNYRVVFCP 125 >sp|P13046.1|PRR1_TOBAC RecName: Full=Pathogenesis-related protein R major form; AltName: Full=Thaumatin-like protein E22; Flags: Precursor gi|19855|emb|CAA33293.1| thaumatin-like protein [Nicotiana tabacum] gi|19980|emb|CAA31235.1| unnamed protein product [Nicotiana tabacum] gi|58200453|gb|AAW66482.1| thaumatin-like protein [Nicotiana tabacum] Length = 226 Score = 203 bits (516), Expect = 1e-50 Identities = 90/109 (82%), Positives = 95/109 (87%), Gaps = 1/109 (0%) Frame = -3 Query: 482 FFDISLVDGFNIPMDFSPT-GGCRGIRCTADINGQCPAQLRAPGGCNNPCTVFRTNEYCC 306 F DISLVDGFNIPM+FSPT GGCR +RCTA IN QCPAQL+ GGCNNPCTV +TNEYCC Sbjct: 118 FVDISLVDGFNIPMEFSPTNGGCRNLRCTAPINEQCPAQLKTQGGCNNPCTVIKTNEYCC 177 Query: 305 TNGPGSCRPTEFSRFFKTRCPDAYSYPQDDPTSTFTCTSGGNYRVVFCP 159 TNGPGSC PT+ SRFFK RCPDAYSYPQDDPTS FTC SG NYRVVFCP Sbjct: 178 TNGPGSCGPTDLSRFFKERCPDAYSYPQDDPTSLFTCPSGTNYRVVFCP 226