BLASTX nr result
ID: Aconitum21_contig00000707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00000707 (921 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79327.1| hypothetical protein VITISV_032072 [Vitis vinifera] 184 3e-44 ref|XP_002262911.1| PREDICTED: small ubiquitin-related modifier ... 183 6e-44 ref|XP_002529470.1| conserved hypothetical protein [Ricinus comm... 179 1e-42 ref|XP_002271938.1| PREDICTED: small ubiquitin-related modifier ... 178 1e-42 ref|XP_002521079.1| conserved hypothetical protein [Ricinus comm... 178 2e-42 >emb|CAN79327.1| hypothetical protein VITISV_032072 [Vitis vinifera] Length = 104 Score = 184 bits (466), Expect = 3e-44 Identities = 91/102 (89%), Positives = 94/102 (92%) Frame = +1 Query: 82 MSGTAAPAAGQEEDKKPTDQSGAHINLKVKGQDGNEVFFRIKRSTQMRKLMTAYCDRQSV 261 MS T A GQEEDKKPTDQ GAHINLKVKGQDGNEVFFRIKRSTQ+RKLM+AYCDRQSV Sbjct: 1 MSATGGAAGGQEEDKKPTDQ-GAHINLKVKGQDGNEVFFRIKRSTQLRKLMSAYCDRQSV 59 Query: 262 EFNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGGI 387 E NSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG + Sbjct: 60 ELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGNL 101 >ref|XP_002262911.1| PREDICTED: small ubiquitin-related modifier 2 [Vitis vinifera] gi|296090483|emb|CBI40814.3| unnamed protein product [Vitis vinifera] Length = 103 Score = 183 bits (464), Expect = 6e-44 Identities = 91/100 (91%), Positives = 93/100 (93%) Frame = +1 Query: 82 MSGTAAPAAGQEEDKKPTDQSGAHINLKVKGQDGNEVFFRIKRSTQMRKLMTAYCDRQSV 261 MS T A GQEEDKKPTDQ GAHINLKVKGQDGNEVFFRIKRSTQ+RKLM+AYCDRQSV Sbjct: 1 MSATGGAAGGQEEDKKPTDQ-GAHINLKVKGQDGNEVFFRIKRSTQLRKLMSAYCDRQSV 59 Query: 262 EFNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 381 E NSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG Sbjct: 60 ELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 99 >ref|XP_002529470.1| conserved hypothetical protein [Ricinus communis] gi|223531086|gb|EEF32936.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 179 bits (453), Expect = 1e-42 Identities = 86/90 (95%), Positives = 88/90 (97%) Frame = +1 Query: 112 QEEDKKPTDQSGAHINLKVKGQDGNEVFFRIKRSTQMRKLMTAYCDRQSVEFNSIAFLFD 291 QEEDKKPTDQS AHINLKVKGQDGNEVFFRIKRSTQ++KLM AYCDRQSVEFNSIAFLFD Sbjct: 7 QEEDKKPTDQSAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIAFLFD 66 Query: 292 GRRLRGEQTPDELEMEDGDEIDAMLHQTGG 381 GRRLRGEQTPDELEMEDGDEIDAMLHQTGG Sbjct: 67 GRRLRGEQTPDELEMEDGDEIDAMLHQTGG 96 >ref|XP_002271938.1| PREDICTED: small ubiquitin-related modifier 2 isoform 1 [Vitis vinifera] gi|147785046|emb|CAN71030.1| hypothetical protein VITISV_013543 [Vitis vinifera] Length = 114 Score = 178 bits (452), Expect = 1e-42 Identities = 89/103 (86%), Positives = 93/103 (90%) Frame = +1 Query: 73 TSIMSGTAAPAAGQEEDKKPTDQSGAHINLKVKGQDGNEVFFRIKRSTQMRKLMTAYCDR 252 T ++G A GQEEDKKP DQ GAHINLKVKGQDGNEVFFRIKRSTQ+RKLM+AYCDR Sbjct: 4 TGGVAGAGAGTGGQEEDKKPMDQ-GAHINLKVKGQDGNEVFFRIKRSTQLRKLMSAYCDR 62 Query: 253 QSVEFNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 381 QSVE NSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG Sbjct: 63 QSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 105 >ref|XP_002521079.1| conserved hypothetical protein [Ricinus communis] gi|223539648|gb|EEF41230.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 178 bits (451), Expect = 2e-42 Identities = 88/96 (91%), Positives = 92/96 (95%) Frame = +1 Query: 97 APAAGQEEDKKPTDQSGAHINLKVKGQDGNEVFFRIKRSTQMRKLMTAYCDRQSVEFNSI 276 A A GQEEDKKP DQ+ AHINLKVKGQDGNE+FFRIKRSTQ+RKL+TAYCDRQSVEFNSI Sbjct: 10 AGAGGQEEDKKPMDQT-AHINLKVKGQDGNEMFFRIKRSTQLRKLITAYCDRQSVEFNSI 68 Query: 277 AFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGG 384 AFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGG Sbjct: 69 AFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGG 104