BLASTX nr result
ID: Aconitum21_contig00000395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00000395 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB85086.1| cytochrome c oxidase polypeptide Vc [Jatropha cur... 120 2e-25 ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putativ... 118 4e-25 ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group] g... 117 1e-24 ref|XP_002866426.1| hypothetical protein ARALYDRAFT_496289 [Arab... 116 2e-24 ref|NP_200939.1| putative cytochrome c oxidase subunit 5C-3 [Ara... 114 6e-24 >gb|ADB85086.1| cytochrome c oxidase polypeptide Vc [Jatropha curcas] Length = 63 Score = 120 bits (300), Expect = 2e-25 Identities = 56/63 (88%), Positives = 59/63 (93%) Frame = +2 Query: 11 MAGHKIAHATLKGPSVVKEICIGTVLGLVAGGMWKMHHWNEQRKVRAFYDLLERGEISVV 190 MAG KIAHATLKGPSVVKEICIG LGL AGG+WKMHHWNEQRKVRAFYDLLE+GEISVV Sbjct: 1 MAGGKIAHATLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVV 60 Query: 191 VEE 199 V+E Sbjct: 61 VDE 63 >ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|255559374|ref|XP_002520707.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223540092|gb|EEF41669.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223545762|gb|EEF47266.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] Length = 63 Score = 118 bits (296), Expect = 4e-25 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = +2 Query: 11 MAGHKIAHATLKGPSVVKEICIGTVLGLVAGGMWKMHHWNEQRKVRAFYDLLERGEISVV 190 MAG +IAHATLKGPSVVKEICIG LGL AGG+WKMHHWNEQRKVRAFYDLLE+GEISVV Sbjct: 1 MAGGRIAHATLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVV 60 Query: 191 VEE 199 EE Sbjct: 61 AEE 63 >ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group] gi|48428177|sp|Q9SXX7.3|COX5C_ORYSJ RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome c oxidase polypeptide Vc gi|4850330|dbj|BAA77682.1| cytochrome c oxidase subunit 5c [Oryza sativa Japonica Group] gi|113649528|dbj|BAF30040.1| Os12g0561000 [Oryza sativa Japonica Group] gi|125579724|gb|EAZ20870.1| hypothetical protein OsJ_36508 [Oryza sativa Japonica Group] Length = 63 Score = 117 bits (292), Expect = 1e-24 Identities = 53/63 (84%), Positives = 59/63 (93%) Frame = +2 Query: 11 MAGHKIAHATLKGPSVVKEICIGTVLGLVAGGMWKMHHWNEQRKVRAFYDLLERGEISVV 190 MAG +IAHATLKGPSVVKEICIG LGLVAGG+WKMHHWNEQRK R+FYD+LE+G+ISVV Sbjct: 1 MAGGRIAHATLKGPSVVKEICIGLTLGLVAGGLWKMHHWNEQRKTRSFYDMLEKGQISVV 60 Query: 191 VEE 199 VEE Sbjct: 61 VEE 63 >ref|XP_002866426.1| hypothetical protein ARALYDRAFT_496289 [Arabidopsis lyrata subsp. lyrata] gi|297312261|gb|EFH42685.1| hypothetical protein ARALYDRAFT_496289 [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 116 bits (290), Expect = 2e-24 Identities = 54/63 (85%), Positives = 56/63 (88%) Frame = +2 Query: 11 MAGHKIAHATLKGPSVVKEICIGTVLGLVAGGMWKMHHWNEQRKVRAFYDLLERGEISVV 190 MAGHKIAHATLKGPSVVKE+ IG LGL AGG+WKMHHWNEQRK RAFYDLLERGEI VV Sbjct: 1 MAGHKIAHATLKGPSVVKELVIGLALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEIGVV 60 Query: 191 VEE 199 V E Sbjct: 61 VAE 63 >ref|NP_200939.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|30697511|ref|NP_851239.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|79331798|ref|NP_001032118.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|186532634|ref|NP_001119471.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|48428151|sp|Q9FLK2.1|CX5C3_ARATH RecName: Full=Probable cytochrome c oxidase subunit 5C-3; AltName: Full=Cytochrome c oxidase polypeptide Vc-3 gi|9757852|dbj|BAB08486.1| cytochrome c oxidase Vc subunit-like protein [Arabidopsis thaliana] gi|21593916|gb|AAM65881.1| cytochrome c oxidase subunit-like [Arabidopsis thaliana] gi|88010838|gb|ABD38860.1| At5g61310 [Arabidopsis thaliana] gi|332010067|gb|AED97450.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|332010068|gb|AED97451.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|332010069|gb|AED97452.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|332010070|gb|AED97453.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] Length = 64 Score = 114 bits (286), Expect = 6e-24 Identities = 53/63 (84%), Positives = 55/63 (87%) Frame = +2 Query: 11 MAGHKIAHATLKGPSVVKEICIGTVLGLVAGGMWKMHHWNEQRKVRAFYDLLERGEISVV 190 MAGHKIAHATLKGPSVVKE+ IG LGL AGG+WKMHHWNEQRK R FYDLLERGEI VV Sbjct: 1 MAGHKIAHATLKGPSVVKELVIGLTLGLAAGGLWKMHHWNEQRKTRVFYDLLERGEIGVV 60 Query: 191 VEE 199 V E Sbjct: 61 VTE 63