BLASTX nr result
ID: Aconitum21_contig00000358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00000358 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511060.1| conserved hypothetical protein [Ricinus comm... 87 1e-15 ref|XP_002321771.1| predicted protein [Populus trichocarpa] gi|2... 81 8e-14 ref|NP_001031848.1| uncharacterized protein [Arabidopsis thalian... 80 1e-13 ref|XP_003630439.1| hypothetical protein MTR_8g095540 [Medicago ... 80 1e-13 gb|AAV68879.1| hypothetical protein AT5G07380 [Arabidopsis thali... 80 1e-13 >ref|XP_002511060.1| conserved hypothetical protein [Ricinus communis] gi|223550175|gb|EEF51662.1| conserved hypothetical protein [Ricinus communis] Length = 653 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/61 (68%), Positives = 49/61 (80%) Frame = -2 Query: 222 ETLRDRIGLCYIHKARVSCSDELKIAYCPRGHFGLRDFHHSVSNLPTDAFLPETIESGVA 43 ++L DRIGLCYI K R+S S ELKIAY PRG+F LRDFH +V+NLPTDAFLPE +SG Sbjct: 44 DSLGDRIGLCYIFKNRISSSRELKIAYHPRGNFHLRDFHDAVNNLPTDAFLPEIDDSGAL 103 Query: 42 R 40 R Sbjct: 104 R 104 >ref|XP_002321771.1| predicted protein [Populus trichocarpa] gi|222868767|gb|EEF05898.1| predicted protein [Populus trichocarpa] Length = 620 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/63 (60%), Positives = 47/63 (74%) Frame = -2 Query: 228 QPETLRDRIGLCYIHKARVSCSDELKIAYCPRGHFGLRDFHHSVSNLPTDAFLPETIESG 49 Q +L D+IGLCY+ K R S S ELKI Y PRG+F L DFHH+V+N+PTD+FLPE +SG Sbjct: 41 QSHSLIDKIGLCYLLKHRTSLSHELKIGYSPRGNFNLCDFHHAVNNVPTDSFLPEINDSG 100 Query: 48 VAR 40 R Sbjct: 101 SLR 103 >ref|NP_001031848.1| uncharacterized protein [Arabidopsis thaliana] gi|79508236|ref|NP_196355.2| uncharacterized protein [Arabidopsis thaliana] gi|55978831|gb|AAV68877.1| hypothetical protein AT5G07380 [Arabidopsis thaliana] gi|55978833|gb|AAV68878.1| hypothetical protein AT5G07380 [Arabidopsis thaliana] gi|61742743|gb|AAX55192.1| hypothetical protein At5g07380 [Arabidopsis thaliana] gi|332003765|gb|AED91148.1| uncharacterized protein [Arabidopsis thaliana] gi|332003766|gb|AED91149.1| uncharacterized protein [Arabidopsis thaliana] Length = 641 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/58 (62%), Positives = 47/58 (81%) Frame = -2 Query: 222 ETLRDRIGLCYIHKARVSCSDELKIAYCPRGHFGLRDFHHSVSNLPTDAFLPETIESG 49 ++L DRIGLCYI K R+S +D+LK AY P G+F LRDFHH++++LP DAF+PE ESG Sbjct: 39 DSLTDRIGLCYILKDRISGNDQLKFAYTPTGNFCLRDFHHAINSLPLDAFVPEIDESG 96 >ref|XP_003630439.1| hypothetical protein MTR_8g095540 [Medicago truncatula] gi|355524461|gb|AET04915.1| hypothetical protein MTR_8g095540 [Medicago truncatula] Length = 478 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = -2 Query: 222 ETLRDRIGLCYIHKARVSCSDELKIAYCPRGHFGLRDFHHSVSNLPTDAFLPE 64 +TL D+IGLCY+ K R+S SDEL IAY P G+F LRDFHH+V+NLP+DAFLP+ Sbjct: 45 DTLSDKIGLCYVVKNRLSSSDELMIAYRPVGNFNLRDFHHAVNNLPSDAFLPD 97 >gb|AAV68879.1| hypothetical protein AT5G07380 [Arabidopsis thaliana] Length = 483 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/58 (62%), Positives = 47/58 (81%) Frame = -2 Query: 222 ETLRDRIGLCYIHKARVSCSDELKIAYCPRGHFGLRDFHHSVSNLPTDAFLPETIESG 49 ++L DRIGLCYI K R+S +D+LK AY P G+F LRDFHH++++LP DAF+PE ESG Sbjct: 39 DSLTDRIGLCYILKDRISGNDQLKFAYTPTGNFCLRDFHHAINSLPLDAFVPEIDESG 96