BLASTX nr result
ID: Aconitum21_contig00000203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00000203 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB95220.1| metallothionein type I [Fritillaria agrestis] gi|... 74 1e-11 gb|AAB95219.1| metallothionein type I [Fritillaria agrestis] 74 1e-11 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 74 2e-11 gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] 73 2e-11 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 73 3e-11 >gb|AAB95220.1| metallothionein type I [Fritillaria agrestis] gi|183013702|gb|ACC38380.1| metallothionein-like protein [Lilium formosanum] Length = 63 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -1 Query: 322 MSNNCGNCDCADKSQCVKKGNSFGIEIIETEKSYYDNVSMAAEND 188 MS+ CGNCDCADK+QCVKK NSFG+ I+ETEKSY+D + AE+D Sbjct: 1 MSSTCGNCDCADKNQCVKKSNSFGVVIMETEKSYFDGMMDVAEHD 45 >gb|AAB95219.1| metallothionein type I [Fritillaria agrestis] Length = 63 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -1 Query: 322 MSNNCGNCDCADKSQCVKKGNSFGIEIIETEKSYYDNVSMAAEND 188 MS+ CGNCDCADK+QCVKK NSFG+ I+ETEKSY+D + AE+D Sbjct: 1 MSSTCGNCDCADKNQCVKKSNSFGVVIMETEKSYFDGMMDVAEHD 45 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 316 NNCGNCDCADKSQCVKKGNSFGIEIIETEKSYYDNVSMAAE 194 + CGNCDC DKSQCVKKGNS+GI+I+ETEKSY D V +AAE Sbjct: 2 STCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVAAE 42 >gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] Length = 64 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/45 (73%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = -1 Query: 316 NNCGNCDCADKSQCVKKGNSFGIEIIETEKSYYDNV--SMAAEND 188 + CGNCDCADKSQCVKKGNS+G+EIIETEKSY+D V AA+N+ Sbjct: 2 STCGNCDCADKSQCVKKGNSYGVEIIETEKSYHDGVFEVAAAKNE 46 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/46 (73%), Positives = 39/46 (84%), Gaps = 3/46 (6%) Frame = -1 Query: 316 NNCGNCDCADKSQCVKKGNSFGIEIIETEKSYYDNV---SMAAEND 188 + CGNCDCADKSQCVKKGNS+GIEIIETEKSY D+V AA+N+ Sbjct: 2 STCGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVVEAPAAAKNE 47