BLASTX nr result
ID: Aconitum21_contig00000129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00000129 (602 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511150.1| metal ion binding protein, putative [Ricinus... 64 2e-08 ref|XP_002865821.1| hypothetical protein ARALYDRAFT_495136 [Arab... 59 9e-07 ref|XP_004138039.1| PREDICTED: uncharacterized protein LOC101211... 58 1e-06 gb|ADT78695.1| metal ion binding protein [Phaseolus vulgaris] 58 1e-06 ref|NP_001119410.1| Heavy-metal-associated domain--containing pr... 57 2e-06 >ref|XP_002511150.1| metal ion binding protein, putative [Ricinus communis] gi|223550265|gb|EEF51752.1| metal ion binding protein, putative [Ricinus communis] Length = 349 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 375 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 271 KNE YYYPP+Y ME YAYPPQIFSDENPNAC +M Sbjct: 316 KNEYYYYPPRYAMEL-YAYPPQIFSDENPNACSVM 349 >ref|XP_002865821.1| hypothetical protein ARALYDRAFT_495136 [Arabidopsis lyrata subsp. lyrata] gi|297311656|gb|EFH42080.1| hypothetical protein ARALYDRAFT_495136 [Arabidopsis lyrata subsp. lyrata] Length = 284 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 375 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 271 KNE Y PP+YP+E +AYPPQIFSDENPNAC IM Sbjct: 251 KNEYQYQPPRYPVEM-FAYPPQIFSDENPNACTIM 284 >ref|XP_004138039.1| PREDICTED: uncharacterized protein LOC101211886 [Cucumis sativus] Length = 314 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 375 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 271 KNE +YYP +Y ME YAYPPQ+FSDENPNAC IM Sbjct: 281 KNEYHYYPQRYIMEM-YAYPPQMFSDENPNACSIM 314 >gb|ADT78695.1| metal ion binding protein [Phaseolus vulgaris] Length = 314 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/39 (71%), Positives = 31/39 (79%), Gaps = 4/39 (10%) Frame = -3 Query: 375 KNELYYYPPKYPME-YAY---AYPPQIFSDENPNACFIM 271 K+E YY PP+Y ME YAY AYPPQIFSDENPNAC +M Sbjct: 276 KSEYYYNPPRYGMEFYAYPGPAYPPQIFSDENPNACSVM 314 >ref|NP_001119410.1| Heavy-metal-associated domain--containing protein [Arabidopsis thaliana] gi|332008603|gb|AED95986.1| Heavy-metal-associated domain--containing protein [Arabidopsis thaliana] Length = 290 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -3 Query: 375 KNELYYYPPKYPMEYAYAYPPQIFSDENPNACFIM 271 KNE Y PP+YP+E +AYPPQIFSDENPNAC I+ Sbjct: 257 KNEYQYQPPRYPVEM-FAYPPQIFSDENPNACTII 290