BLASTX nr result
ID: Achyranthes23_contig00057696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00057696 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534671.1| hypothetical protein RCOM_2090500 [Ricinus c... 60 3e-07 ref|XP_002865850.1| kinase family protein [Arabidopsis lyrata su... 60 4e-07 ref|XP_002865849.1| predicted protein [Arabidopsis lyrata subsp.... 60 4e-07 gb|EMJ20119.1| hypothetical protein PRUPE_ppa001518mg [Prunus pe... 59 7e-07 ref|XP_006413335.1| hypothetical protein EUTSA_v10024396mg [Eutr... 59 9e-07 ref|NP_199940.1| U-box domain-containing protein 53 [Arabidopsis... 58 1e-06 ref|XP_006385122.1| hypothetical protein POPTR_0004s24130g [Popu... 58 1e-06 ref|NP_194246.2| U-box domain-containing protein kinase family p... 58 1e-06 ref|XP_002328828.1| predicted protein [Populus trichocarpa] 58 1e-06 emb|CAB36758.1| putative Ser/Thr protein kinase [Arabidopsis tha... 58 1e-06 gb|EMT31075.1| U-box domain-containing protein 35 [Aegilops taus... 57 2e-06 gb|EMS55617.1| U-box domain-containing protein 35 [Triticum urartu] 57 2e-06 ref|XP_006279824.1| hypothetical protein CARUB_v10028126mg [Caps... 57 2e-06 gb|EOY22801.1| U-box domain-containing protein kinase family pro... 57 3e-06 gb|EOY22800.1| U-box domain-containing protein kinase family pro... 57 3e-06 ref|XP_002867622.1| kinase family protein [Arabidopsis lyrata su... 57 3e-06 ref|XP_006401994.1| hypothetical protein EUTSA_v10012716mg [Eutr... 56 4e-06 ref|XP_003557213.1| PREDICTED: U-box domain-containing protein 3... 56 4e-06 gb|ABL85042.1| serine threonine kinase [Brachypodium sylvaticum] 56 4e-06 ref|XP_006283114.1| hypothetical protein CARUB_v10004133mg [Caps... 56 6e-06 >ref|XP_002534671.1| hypothetical protein RCOM_2090500 [Ricinus communis] gi|223524795|gb|EEF27713.1| hypothetical protein RCOM_2090500 [Ricinus communis] Length = 364 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = -3 Query: 242 GSRLEMAESK--VAEQDQLLVGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKIT 69 GS + AE+K + L VG+A+ G R+SK+++ WA+EKF NV FKLLHV PKIT Sbjct: 3 GSEIVEAENKFGLPPIPPLTVGIAIDGKRKSKYVVYWALEKFIPKENVVFKLLHVRPKIT 62 Query: 68 LVP 60 VP Sbjct: 63 AVP 65 >ref|XP_002865850.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297311685|gb|EFH42109.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 812 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/69 (40%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Frame = -3 Query: 224 AESKVAEQDQ-LLVGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVPDNEE 48 A S +A Q L + +A++GS +SK++++WA++KF + NV FKL+H++PK+T VP Sbjct: 23 ASSDLASPSQPLTIAIAISGSSKSKNVVKWALKKFGSEENVIFKLIHIHPKLTSVPTPSG 82 Query: 47 STVYLFVYP 21 +TV + P Sbjct: 83 NTVSISEAP 91 >ref|XP_002865849.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311684|gb|EFH42108.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 854 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -3 Query: 224 AESKVAEQDQLL-VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 A S +A Q L + +A++GS +SK++L+WA+ KF + NVTFKL+H++PKIT +P Sbjct: 23 ASSDLASPSQPLNIAIAISGSDKSKNVLKWALNKFGSDKNVTFKLIHIHPKITTLP 78 >gb|EMJ20119.1| hypothetical protein PRUPE_ppa001518mg [Prunus persica] Length = 810 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = -3 Query: 191 LVGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 +V +A+ G+R+SK+I+RWA+EKF GNV FKL+HV P+IT VP Sbjct: 24 IVAIAINGNRKSKYIVRWALEKFVPEGNVFFKLIHVRPRITGVP 67 >ref|XP_006413335.1| hypothetical protein EUTSA_v10024396mg [Eutrema salsugineum] gi|557114505|gb|ESQ54788.1| hypothetical protein EUTSA_v10024396mg [Eutrema salsugineum] Length = 841 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = -3 Query: 188 VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 V VAL+GSR++K+++ WA+EKF GNV FKLLH++P+IT VP Sbjct: 28 VVVALSGSRKNKNVVTWALEKFAPEGNVGFKLLHIHPRITSVP 70 >ref|NP_199940.1| U-box domain-containing protein 53 [Arabidopsis thaliana] gi|75335492|sp|Q9LU47.1|PUB53_ARATH RecName: Full=Putative U-box domain-containing protein 53; AltName: Full=Plant U-box protein 53; Includes: RecName: Full=E3 ubiquitin ligase; Includes: RecName: Full=Serine/threonine-protein kinase gi|8843864|dbj|BAA97390.1| unnamed protein product [Arabidopsis thaliana] gi|332008677|gb|AED96060.1| U-box domain-containing protein 53 [Arabidopsis thaliana] Length = 819 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/50 (46%), Positives = 39/50 (78%) Frame = -3 Query: 209 AEQDQLLVGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 A + + V +A++GS +SK++++WA+ KF + NVTFKL+H++PKIT +P Sbjct: 27 APSEPMTVALAISGSIKSKNVIKWALNKFGSDKNVTFKLIHIHPKITTLP 76 >ref|XP_006385122.1| hypothetical protein POPTR_0004s24130g [Populus trichocarpa] gi|550341890|gb|ERP62919.1| hypothetical protein POPTR_0004s24130g [Populus trichocarpa] Length = 824 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 9/65 (13%) Frame = -3 Query: 227 MAESKVAEQDQLL---------VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPK 75 M +S++ E++ +L VG+A+ G SK++++WA+EKF G V FKLLHV PK Sbjct: 6 MEQSEIIEEEHVLGLPPSPPLTVGIAIDGKGSSKYLVQWALEKFMPQGKVAFKLLHVCPK 65 Query: 74 ITLVP 60 IT VP Sbjct: 66 ITAVP 70 >ref|NP_194246.2| U-box domain-containing protein kinase family protein [Arabidopsis thaliana] gi|172044784|sp|Q9SW11.2|PUB35_ARATH RecName: Full=U-box domain-containing protein 35; AltName: Full=Plant U-box protein 35; Includes: RecName: Full=E3 ubiquitin ligase; Includes: RecName: Full=Serine/threonine-protein kinase gi|332659618|gb|AEE85018.1| U-box domain-containing protein kinase family protein [Arabidopsis thaliana] Length = 835 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 188 VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 V VAL+GS +SK+++ WA+EKF GNV FKLLH++P IT VP Sbjct: 22 VVVALSGSSKSKYVVTWAIEKFATEGNVGFKLLHIHPMITSVP 64 >ref|XP_002328828.1| predicted protein [Populus trichocarpa] Length = 67 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 9/65 (13%) Frame = -3 Query: 227 MAESKVAEQDQLL---------VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPK 75 M +S++ E++ +L VG+A+ G SK++++WA+EKF G V FKLLHV PK Sbjct: 1 MEQSEIIEEEHVLGLPPSPPLTVGIAIDGKGSSKYLVQWALEKFMPQGKVAFKLLHVCPK 60 Query: 74 ITLVP 60 IT VP Sbjct: 61 ITAVP 65 >emb|CAB36758.1| putative Ser/Thr protein kinase [Arabidopsis thaliana] gi|7269366|emb|CAB79425.1| putative Ser/Thr protein kinase [Arabidopsis thaliana] Length = 814 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 188 VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 V VAL+GS +SK+++ WA+EKF GNV FKLLH++P IT VP Sbjct: 22 VVVALSGSSKSKYVVTWAIEKFATEGNVGFKLLHIHPMITSVP 64 >gb|EMT31075.1| U-box domain-containing protein 35 [Aegilops tauschii] Length = 824 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -3 Query: 188 VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 V +A++GSR S+H L+WA++KF GG V F++LHV P IT+VP Sbjct: 25 VAIAVSGSRSSRHALKWALDKFVPGGRVLFRILHVRPPITMVP 67 >gb|EMS55617.1| U-box domain-containing protein 35 [Triticum urartu] Length = 826 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -3 Query: 188 VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 V +A++GSR S+H L+WA++KF GG V F++LHV P IT+VP Sbjct: 25 VAIAVSGSRSSRHALKWALDKFVPGGRVLFRILHVRPPITMVP 67 >ref|XP_006279824.1| hypothetical protein CARUB_v10028126mg [Capsella rubella] gi|387169549|gb|AFJ66208.1| hypothetical protein 34G24.6 [Capsella rubella] gi|482548528|gb|EOA12722.1| hypothetical protein CARUB_v10028126mg [Capsella rubella] Length = 810 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/52 (44%), Positives = 39/52 (75%) Frame = -3 Query: 194 LLVGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVPDNEESTV 39 L + +A++GS +SK++++WA+ KF + NV FKL+HV+PK+T +P +TV Sbjct: 34 LTIAIAISGSSKSKNVVKWALNKFGSDKNVVFKLIHVHPKLTSLPTPSGNTV 85 >gb|EOY22801.1| U-box domain-containing protein kinase family protein isoform 2 [Theobroma cacao] Length = 817 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -3 Query: 194 LLVGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 L +G+A+ G+R+SK++++WA+EKF NV FKLLHV KIT VP Sbjct: 23 LNIGIAINGNRKSKYVVKWALEKFITEENVMFKLLHVRAKITTVP 67 >gb|EOY22800.1| U-box domain-containing protein kinase family protein isoform 1 [Theobroma cacao] Length = 831 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -3 Query: 194 LLVGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 L +G+A+ G+R+SK++++WA+EKF NV FKLLHV KIT VP Sbjct: 23 LNIGIAINGNRKSKYVVKWALEKFITEENVMFKLLHVRAKITTVP 67 >ref|XP_002867622.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297313458|gb|EFH43881.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 832 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 188 VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 V VAL+GS +SK+++ WA+EKF GNV FKLLH++P IT VP Sbjct: 22 VVVALSGSSKSKYVVTWALEKFAPEGNVGFKLLHIHPMITSVP 64 >ref|XP_006401994.1| hypothetical protein EUTSA_v10012716mg [Eutrema salsugineum] gi|557103084|gb|ESQ43447.1| hypothetical protein EUTSA_v10012716mg [Eutrema salsugineum] Length = 809 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/51 (43%), Positives = 38/51 (74%) Frame = -3 Query: 212 VAEQDQLLVGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 V+ + + VA++GS +SK+++RWA++KF + NV FKL+H++PKI +P Sbjct: 28 VSTSQSVTIAVAISGSNKSKNVVRWALKKFGSDKNVVFKLIHIHPKIMSLP 78 >ref|XP_003557213.1| PREDICTED: U-box domain-containing protein 35-like [Brachypodium distachyon] Length = 836 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -3 Query: 188 VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 V +A++GS+ S+H L+WA++KF GG V F++LHV P IT+VP Sbjct: 20 VAIAVSGSKSSRHALKWALDKFVPGGRVLFRILHVRPPITMVP 62 >gb|ABL85042.1| serine threonine kinase [Brachypodium sylvaticum] Length = 829 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -3 Query: 188 VGVALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 V +A++GS+ S+H L+WA++KF GG V F++LHV P IT+VP Sbjct: 20 VAIAVSGSKSSRHALKWALDKFVPGGKVLFRILHVRPPITMVP 62 >ref|XP_006283114.1| hypothetical protein CARUB_v10004133mg [Capsella rubella] gi|482551819|gb|EOA16012.1| hypothetical protein CARUB_v10004133mg [Capsella rubella] Length = 830 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -3 Query: 182 VALTGSRRSKHILRWAVEKFHNGGNVTFKLLHVYPKITLVP 60 VAL+GS +SK+++ WA+EKF GNV FKLLH++P IT VP Sbjct: 20 VALSGSSKSKNVVTWALEKFAPEGNVGFKLLHIHPMITSVP 60