BLASTX nr result
ID: Achyranthes23_contig00057638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00057638 (291 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006286358.1| hypothetical protein CARUB_v10000186mg [Caps... 55 1e-05 >ref|XP_006286358.1| hypothetical protein CARUB_v10000186mg [Capsella rubella] gi|482555064|gb|EOA19256.1| hypothetical protein CARUB_v10000186mg [Capsella rubella] Length = 886 Score = 55.1 bits (131), Expect = 1e-05 Identities = 38/115 (33%), Positives = 61/115 (53%), Gaps = 23/115 (20%) Frame = +1 Query: 10 KRKLEDSDSSST-------------RIHPKNSSYSKGKSVIDGYECG----------TEN 120 KRKL+D D+SS+ + H ++ ++ ++++ + CG + + Sbjct: 29 KRKLDDFDASSSPDYVGVVDFFHKMKKHEVDADHTAQQTLVS-WRCGENFAFNRSFSSSS 87 Query: 121 SNNCKTEGESSRSNSGLLMPSVELQFFVRMISGGKTLVLRAKLDDTVEMVHQMIE 285 S + + GE S SN S LQ FVRM+SGGKT+V+ A +DTVE +H+ IE Sbjct: 88 SYSSPSPGECSSSNRS---ESTRLQIFVRMMSGGKTIVIHADRNDTVEKLHERIE 139