BLASTX nr result
ID: Achyranthes23_contig00057580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00057580 (263 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ28015.1| hypothetical protein PRUPE_ppa017701mg [Prunus pe... 55 1e-05 >gb|EMJ28015.1| hypothetical protein PRUPE_ppa017701mg [Prunus persica] Length = 567 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = +3 Query: 3 DLSIQFVEFDDIRKCFFCLHHDIKHVTKNTIKADFIRMYKREKERLK-TRPSIISRIAIT 179 DL QFVE+ IR+ F + DIK V++NT KAD + +Y REK +LK S+ R+ +T Sbjct: 139 DLPFQFVEYSGIRQLFNYVCADIKLVSRNTAKADVLSLYNREKAKLKEILGSVPGRVCLT 198 Query: 180 CDC*SSIT 203 D +SIT Sbjct: 199 SDLWTSIT 206