BLASTX nr result
ID: Achyranthes23_contig00057562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00057562 (313 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris ... 69 1e-10 >gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris subsp. vulgaris] Length = 1631 Score = 68.6 bits (166), Expect(2) = 1e-10 Identities = 41/110 (37%), Positives = 55/110 (50%), Gaps = 29/110 (26%) Frame = +3 Query: 21 ALETYLGCFING*PRR*ATLIDWAKYCYITFPHMSIKMSLLRIAWNK------------- 161 ALETYL CF+ G PR A + WA++ Y T PH S KMS ++ + + Sbjct: 1349 ALETYLRCFVGGHPRSWAKWLPWAEFSYNTSPHTSTKMSPFKVLYGRDPPHVVRAPKGQT 1408 Query: 162 ----------------FDLQVNLIQA*QKMKAFVDVHPREVQFQVGDWVY 263 DLQVNL++A Q+MK + D EV+FQVGD V+ Sbjct: 1409 SVESLEAMLQDRDAIIDDLQVNLVRAQQRMKHYADGSRTEVEFQVGDAVF 1458 Score = 23.1 bits (48), Expect(2) = 1e-10 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +2 Query: 254 LGIQPYRQRSIA 289 L +QPYRQRS+A Sbjct: 1459 LRLQPYRQRSLA 1470