BLASTX nr result
ID: Achyranthes23_contig00057459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00057459 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310258.2| pentatricopeptide repeat-containing family p... 56 6e-06 >ref|XP_002310258.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550334781|gb|EEE90708.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 666 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/55 (50%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 2 KEVGSSWVKIKDEFSPFVSGDKSHPDSDQIYDILYLLTS-GEVFDEKDDALLYDL 163 KE G SW+K KD S FVSGD+SHP+ + IYD+L LL S E+ ++ D LL ++ Sbjct: 607 KEPGWSWIKFKDRVSAFVSGDRSHPEGEYIYDVLDLLASQAEMHMQEMDFLLNEV 661