BLASTX nr result
ID: Achyranthes23_contig00057167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00057167 (239 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004515953.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 >ref|XP_004515953.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Cicer arietinum] Length = 577 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +3 Query: 102 LQKCNSLSHIKQIQSHLISTDFFRFRPSFRVKLLQLTAISSNGDLS 239 LQKCNSL H+KQ+Q+HLI+T F+F PS R KLL+L +IS +GDLS Sbjct: 11 LQKCNSLIHMKQLQAHLITTGKFQFHPS-RTKLLELFSISPSGDLS 55