BLASTX nr result
ID: Achyranthes23_contig00057139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00057139 (278 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004509865.1| PREDICTED: uncharacterized protein LOC101502... 57 3e-06 >ref|XP_004509865.1| PREDICTED: uncharacterized protein LOC101502402 [Cicer arietinum] Length = 175 Score = 56.6 bits (135), Expect = 3e-06 Identities = 39/88 (44%), Positives = 51/88 (57%), Gaps = 14/88 (15%) Frame = +2 Query: 56 TISPAKILIFNNLILHTPPLILR---PRRLNQSLSSILT-----------LRANPPHKYE 193 T+SP+K L +LIL TP LILR P L S SS+ LR +P ++ Sbjct: 11 TLSPSKPLTSKSLILRTPFLILRHYFPCPL--SFSSLYAKPISRNTLTCVLRDSPIQQHV 68 Query: 194 YSDPNPDFVVAETQKFKIELRKKLLNDA 277 YSDP+P+F V ET KFK+EL +KL D+ Sbjct: 69 YSDPSPEFAVFETNKFKVELFQKLSEDS 96