BLASTX nr result
ID: Achyranthes23_contig00057130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00057130 (299 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003587254.1| cytochrome c biogenesis FC [Citrullus lanatu... 57 1e-06 dbj|BAD83536.2| cytochrome c maturation protein CcmFc (mitochond... 58 2e-06 ref|NP_063988.2| ccb438 gene product (mitochondrion) [Beta vulga... 58 2e-06 ref|YP_008802507.1| cytochrome c biogenesis FC (mitochondrion) [... 57 2e-06 ref|YP_003587367.1| cytochrome c biogenesis FC [Cucurbita pepo] ... 57 2e-06 ref|YP_008964115.1| cytochrome c biogenesis Fc (mitochondrion) [... 57 3e-06 ref|YP_005090424.1| ccmFc gene product (mitochondrion) [Boea hyg... 57 3e-06 emb|CBJ20735.1| cytochrome c maturation protein CcmFc [Beta vulg... 56 4e-06 >ref|YP_003587254.1| cytochrome c biogenesis FC [Citrullus lanatus] gi|259156765|gb|ACV96627.1| cytochrome c biogenesis FC [Citrullus lanatus] Length = 438 Score = 57.4 bits (137), Expect(2) = 1e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 270 PILLPDIIGRSSSKTRARNALFCFVPILN 184 PILLPDIIGRSSS+TRARNALFCFVP+L+ Sbjct: 82 PILLPDIIGRSSSETRARNALFCFVPVLH 110 Score = 20.4 bits (41), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -1 Query: 119 IPKHHKQLREKKRNRK 72 +P+H RE+ R RK Sbjct: 141 LPRHSSAKRERARRRK 156 >dbj|BAD83536.2| cytochrome c maturation protein CcmFc (mitochondrion) [Nicotiana tabacum] Length = 438 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 4/42 (9%) Frame = -3 Query: 270 PILLPDIIGRSSSKTRARNALFCFVPILN----SEKGINSFL 157 PILLPDIIGRSSS+TRARNALFCFVP+L+ KG S+L Sbjct: 82 PILLPDIIGRSSSETRARNALFCFVPVLHFFLLESKGDFSYL 123 >ref|NP_063988.2| ccb438 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435168|ref|YP_004222384.1| cytochrome c maturation protein CcmFc [Beta vulgaris subsp. maritima] gi|346683262|ref|YP_004842190.1| cytochrome c maturation protein CcmFc [Beta macrocarpa] gi|87250873|gb|ABD36063.1| cytochrome c biogenesis Fc [Beta vulgaris subsp. vulgaris] gi|148491413|dbj|BAA99300.2| cytochrome c biogenesis protein [Beta vulgaris subsp. vulgaris] gi|317905621|emb|CBJ14023.1| cytochrome c maturation protein [Beta vulgaris subsp. maritima] gi|319439901|emb|CBJ17598.1| cytochrome c maturation protein CcmFc [Beta vulgaris subsp. maritima] gi|345500180|emb|CBX24999.1| cytochrome c maturation protein CcmFc [Beta macrocarpa] gi|384939163|emb|CBL52010.1| cytochrome c maturation protein CcmFc (mitochondrion) [Beta vulgaris subsp. maritima] Length = 438 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 270 PILLPDIIGRSSSKTRARNALFCFVPILN 184 PILLPDIIGRSSS+TRARNALFCFVPIL+ Sbjct: 82 PILLPDIIGRSSSETRARNALFCFVPILH 110 >ref|YP_008802507.1| cytochrome c biogenesis FC (mitochondrion) [Asclepias syriaca] gi|556562345|gb|AGZ63041.1| cytochrome c biogenesis FC (mitochondrion) [Asclepias syriaca] Length = 427 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 270 PILLPDIIGRSSSKTRARNALFCFVPILN 184 PILLPDIIGRSSS+TRARNALFCFVP+L+ Sbjct: 82 PILLPDIIGRSSSETRARNALFCFVPVLH 110 >ref|YP_003587367.1| cytochrome c biogenesis FC [Cucurbita pepo] gi|259156808|gb|ACV96669.1| cytochrome c biogenesis FC [Cucurbita pepo] Length = 437 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 4/41 (9%) Frame = -3 Query: 270 PILLPDIIGRSSSKTRARNALFCFVPILN----SEKGINSF 160 PILLPDIIGRSSS+TRARNALFCFVP+L+ S KG S+ Sbjct: 82 PILLPDIIGRSSSETRARNALFCFVPLLHFLLLSSKGDFSY 122 >ref|YP_008964115.1| cytochrome c biogenesis Fc (mitochondrion) [Ajuga reptans] gi|558697215|gb|AHA84969.1| cytochrome c biogenesis Fc (mitochondrion) [Ajuga reptans] Length = 438 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 4/42 (9%) Frame = -3 Query: 270 PILLPDIIGRSSSKTRARNALFCFVPILN----SEKGINSFL 157 PILLPDIIGRSSS+TRARNALF FVP+L+ KG NS+L Sbjct: 82 PILLPDIIGRSSSETRARNALFRFVPVLHFLLLESKGDNSYL 123 >ref|YP_005090424.1| ccmFc gene product (mitochondrion) [Boea hygrometrica] gi|340549495|gb|AEK53316.1| cytochrome c biogenesis FC (mitochondrion) [Boea hygrometrica] Length = 463 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 4/42 (9%) Frame = -3 Query: 270 PILLPDIIGRSSSKTRARNALFCFVPILN----SEKGINSFL 157 PILLPDIIGRSSS+TRARNALF FVP+L+ KG NS+L Sbjct: 82 PILLPDIIGRSSSETRARNALFRFVPVLHFLLLESKGDNSYL 123 >emb|CBJ20735.1| cytochrome c maturation protein CcmFc [Beta vulgaris subsp. maritima] Length = 438 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 270 PILLPDIIGRSSSKTRARNALFCFVPILN 184 PILLPDIIGRSSS+TRARNA FCFVPIL+ Sbjct: 82 PILLPDIIGRSSSETRARNAFFCFVPILH 110