BLASTX nr result
ID: Achyranthes23_contig00057044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00057044 (355 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74273.1| hypothetical protein M569_00483, partial [Genlise... 87 2e-15 ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomen... 81 2e-13 ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicot... 81 2e-13 ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabac... 79 8e-13 ref|XP_002886851.1| hypothetical protein ARALYDRAFT_893949 [Arab... 70 1e-12 >gb|EPS74273.1| hypothetical protein M569_00483, partial [Genlisea aurea] Length = 81 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = +2 Query: 197 NGRYYWKDSSLDNRYCNWYSCDRFNRYFLLWFIFRIRLITVVI 325 NGR+YWKDSSLDNRYCNWYSCD NRYFLLW IFRIR I VVI Sbjct: 4 NGRHYWKDSSLDNRYCNWYSCDWLNRYFLLWVIFRIRFIPVVI 46 >ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomentosiformis] gi|80750940|dbj|BAE48016.1| hypothetical protein [Nicotiana tomentosiformis] Length = 99 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 351 FHIYASVHSITTVMSLIRNMNHKRKYLLNRSQEYQLQYLLSKEESFQ 211 FH+ S+HSITT M+ IRNMNHKRKYLLNR QEYQLQYLLSKEESFQ Sbjct: 53 FHVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 >ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453920|gb|AEO95578.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454031|gb|AEO95688.1| hypothetical protein [synthetic construct] Length = 99 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 351 FHIYASVHSITTVMSLIRNMNHKRKYLLNRSQEYQLQYLLSKEESFQ 211 FH+ S+HSITT M+ IRNMNHKRKYLLNR QEYQLQYLLSKEESFQ Sbjct: 53 FHVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 >ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabacum] gi|78102550|ref|YP_358691.1| hypothetical protein NisyCp046 [Nicotiana sylvestris] gi|11846|emb|CAA77366.1| hypothetical protein [Nicotiana tabacum] gi|77799577|dbj|BAE46666.1| hypothetical protein [Nicotiana sylvestris] gi|225214|prf||1211235AV ORF 99A Length = 99 Score = 78.6 bits (192), Expect = 8e-13 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 351 FHIYASVHSITTVMSLIRNMNHKRKYLLNRSQEYQLQYLLSKEESFQ 211 FH+ S+HSIT M+ IRNMNHKRKYLLNR QEYQLQYLLSKEESFQ Sbjct: 53 FHVDDSIHSITRGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 >ref|XP_002886851.1| hypothetical protein ARALYDRAFT_893949 [Arabidopsis lyrata subsp. lyrata] gi|297332692|gb|EFH63110.1| hypothetical protein ARALYDRAFT_893949 [Arabidopsis lyrata subsp. lyrata] Length = 85 Score = 69.7 bits (169), Expect(2) = 1e-12 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +2 Query: 221 SSLDNRYCNWYSCDRFNRYFLLWFIFRIRLITVVI 325 SSL NRYC+WYSCDRFNRYFLLWFIFRIR I V I Sbjct: 50 SSLGNRYCSWYSCDRFNRYFLLWFIFRIRFIPVEI 84 Score = 28.9 bits (63), Expect(2) = 1e-12 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +1 Query: 160 HDYLMKCGGKWGKWPI 207 HD+ MKCGGK KW I Sbjct: 30 HDHSMKCGGKRDKWLI 45