BLASTX nr result
ID: Achyranthes23_contig00056305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00056305 (272 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313825.2| allene oxide synthase family protein [Populu... 58 1e-06 emb|CAC86899.1| 9/13 hydroperoxide lyase [Medicago truncatula] 57 3e-06 ref|XP_004498182.1| PREDICTED: allene oxide synthase, chloroplas... 57 3e-06 gb|EMJ01187.1| hypothetical protein PRUPE_ppa025045mg [Prunus pe... 57 3e-06 emb|CAE18065.1| cytochrome P450 [Prunus dulcis] gi|529407045|gb|... 57 3e-06 ref|XP_002334133.1| cytochrome P450 [Populus trichocarpa] 55 1e-05 ref|XP_002305405.1| allene oxide synthase family protein [Populu... 55 1e-05 gb|ABK93995.1| unknown [Populus trichocarpa] 55 1e-05 >ref|XP_002313825.2| allene oxide synthase family protein [Populus trichocarpa] gi|550331506|gb|EEE87780.2| allene oxide synthase family protein [Populus trichocarpa] Length = 482 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/51 (60%), Positives = 39/51 (76%), Gaps = 4/51 (7%) Frame = -2 Query: 271 KQCPGKNLVELMSFVLLVEFFLQYDTFSIDTSN----DSTVNFLSLKKASN 131 KQCPGK+LV L+S VLLVEFFL+YDTF++ T++ STV F SL KA + Sbjct: 431 KQCPGKDLVLLLSRVLLVEFFLRYDTFTVKTASALALGSTVTFTSLIKAKS 481 >emb|CAC86899.1| 9/13 hydroperoxide lyase [Medicago truncatula] Length = 485 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/51 (56%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = -2 Query: 271 KQCPGKNLVELMSFVLLVEFFLQYDTFSIDTSND---STVNFLSLKKASNI 128 KQCPGKNLV L+ +LLVEFFL+YDTF +T N+ + V+ SL KAS++ Sbjct: 435 KQCPGKNLVVLLCRLLLVEFFLRYDTFENETKNNAFGAAVSITSLTKASSV 485 >ref|XP_004498182.1| PREDICTED: allene oxide synthase, chloroplastic-like [Cicer arietinum] Length = 485 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/51 (54%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = -2 Query: 271 KQCPGKNLVELMSFVLLVEFFLQYDTFSIDTSN---DSTVNFLSLKKASNI 128 KQCPGKNLV L+ + LVEFFL+YDTF ++T N ++V+ SL KAS++ Sbjct: 435 KQCPGKNLVVLLCRLFLVEFFLRYDTFVVETKNVAFGASVSITSLTKASSV 485 >gb|EMJ01187.1| hypothetical protein PRUPE_ppa025045mg [Prunus persica] Length = 482 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/49 (59%), Positives = 37/49 (75%), Gaps = 3/49 (6%) Frame = -2 Query: 271 KQCPGKNLVELMSFVLLVEFFLQYDTFSIDTSN---DSTVNFLSLKKAS 134 KQCPGK+LV L+S ++LVEFFL+YDTF++D S+V F SL KAS Sbjct: 434 KQCPGKDLVVLISRLILVEFFLRYDTFTVDAGTVLLGSSVTFKSLTKAS 482 >emb|CAE18065.1| cytochrome P450 [Prunus dulcis] gi|529407045|gb|AGT02045.1| hydroperoxide lyase [synthetic construct] Length = 483 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/49 (59%), Positives = 37/49 (75%), Gaps = 3/49 (6%) Frame = -2 Query: 271 KQCPGKNLVELMSFVLLVEFFLQYDTFSIDTSN---DSTVNFLSLKKAS 134 KQCPGK+LV L+S ++LVEFFL+YDTF++D S+V F SL KAS Sbjct: 435 KQCPGKDLVVLISRLMLVEFFLRYDTFTVDAGTVLLGSSVTFKSLTKAS 483 >ref|XP_002334133.1| cytochrome P450 [Populus trichocarpa] Length = 151 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/51 (54%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = -2 Query: 271 KQCPGKNLVELMSFVLLVEFFLQYDTFSIDTS---NDSTVNFLSLKKASNI 128 KQCPGK++V L+S +LLVEFFL+YDTF+++T+ S+V SL KA++I Sbjct: 101 KQCPGKDMVVLLSRLLLVEFFLRYDTFTVETAVLPIGSSVTLTSLGKATSI 151 >ref|XP_002305405.1| allene oxide synthase family protein [Populus trichocarpa] gi|222848369|gb|EEE85916.1| allene oxide synthase family protein [Populus trichocarpa] Length = 481 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/51 (54%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = -2 Query: 271 KQCPGKNLVELMSFVLLVEFFLQYDTFSIDTS---NDSTVNFLSLKKASNI 128 KQCPGK++V L+S +LLVEFFL+YDTF+++T+ S+V SL KA++I Sbjct: 431 KQCPGKDMVVLLSRLLLVEFFLRYDTFTVETAVLPIGSSVTLTSLGKATSI 481 >gb|ABK93995.1| unknown [Populus trichocarpa] Length = 481 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/51 (54%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = -2 Query: 271 KQCPGKNLVELMSFVLLVEFFLQYDTFSIDTS---NDSTVNFLSLKKASNI 128 KQCPGK++V L+S +LLVEFFL+YDTF+++T+ S+V SL KA++I Sbjct: 431 KQCPGKDMVVLLSRLLLVEFFLRYDTFTVETAVLPIGSSVTLTSLGKATSI 481