BLASTX nr result
ID: Achyranthes23_contig00056227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00056227 (201 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510783.1| AMP dependent CoA ligase, putative [Ricinus ... 55 7e-06 >ref|XP_002510783.1| AMP dependent CoA ligase, putative [Ricinus communis] gi|223549898|gb|EEF51385.1| AMP dependent CoA ligase, putative [Ricinus communis] Length = 521 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = -1 Query: 171 PINNDCSTEKFEIYLSTYEPKLLLT--DDNVAAQTAALNYNIPHATVLLTSQDSDITFT 1 P+N +TE+FE YLS E KLLLT + N +AQ+AA NIPHAT +L + DS+++ + Sbjct: 84 PLNAAYTTEEFEFYLSDSESKLLLTPLEGNSSAQSAASKLNIPHATAVLPAADSELSLS 142