BLASTX nr result
ID: Achyranthes23_contig00056184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00056184 (268 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006439440.1| hypothetical protein CICLE_v10019724mg [Citr... 81 2e-13 ref|XP_003517491.2| PREDICTED: calcium-dependent protein kinase ... 77 2e-12 gb|AFW83320.1| putative calcium-dependent protein kinase family ... 77 3e-12 ref|XP_003525360.1| PREDICTED: calcium-dependent protein kinase ... 77 3e-12 gb|ESW32118.1| hypothetical protein PHAVU_002G294500g [Phaseolus... 76 4e-12 ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase ... 75 7e-12 ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus ... 75 7e-12 gb|AFW81270.1| putative calcium-dependent protein kinase family ... 75 1e-11 gb|AFW81269.1| putative calcium-dependent protein kinase family ... 75 1e-11 ref|XP_002441592.1| hypothetical protein SORBIDRAFT_09g029950 [S... 75 1e-11 gb|ESW32622.1| hypothetical protein PHAVU_001G003300g [Phaseolus... 74 2e-11 gb|ESW32615.1| hypothetical protein PHAVU_001G002800g [Phaseolus... 74 2e-11 ref|XP_006446309.1| hypothetical protein CICLE_v10014854mg [Citr... 74 2e-11 ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citr... 74 2e-11 ref|XP_006439442.1| hypothetical protein CICLE_v10019724mg [Citr... 74 2e-11 ref|XP_006439441.1| hypothetical protein CICLE_v10019724mg [Citr... 74 2e-11 gb|EOY32872.1| Calcium-dependent protein kinase 17 [Theobroma ca... 74 2e-11 gb|EOY24889.1| Calcium-dependent protein kinase 6 isoform 2 [The... 74 2e-11 gb|EOY24888.1| Calcium-dependent protein kinase 6 isoform 1 [The... 74 2e-11 ref|XP_003567833.1| PREDICTED: calcium-dependent protein kinase ... 74 2e-11 >ref|XP_006439440.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] gi|557541702|gb|ESR52680.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] Length = 350 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALSKFL 164 TE IF++ILRG++D +S PWP+IS SAKD+VKKMLR DPKERLSA E LSKFL Sbjct: 273 TEQSIFDAILRGHIDFSSDPWPNISSSAKDIVKKMLRADPKERLSAAEVLSKFL 326 >ref|XP_003517491.2| PREDICTED: calcium-dependent protein kinase 3-like [Glycine max] Length = 528 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +3 Query: 6 E*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEAL 152 E GIF++ILRG++D TS PWPSIS SAKDLVKKMLR DPK+RLSA+E L Sbjct: 283 EQGIFDAILRGHIDFTSDPWPSISSSAKDLVKKMLRADPKQRLSAVEVL 331 >gb|AFW83320.1| putative calcium-dependent protein kinase family protein [Zea mays] Length = 373 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = +3 Query: 6 E*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALSK 158 E GIF+++LRG++D +S PWPSIS AKDLVKKMLR+DPKERL+A E LSK Sbjct: 283 EDGIFDAVLRGHIDFSSDPWPSISNGAKDLVKKMLRQDPKERLTAAEILSK 333 >ref|XP_003525360.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 [Glycine max] Length = 518 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = +3 Query: 6 E*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 E GIF++ILRG++D S PWPSIS SAKDLVKKMLR DPKERLSA+E L+ Sbjct: 270 EQGIFDAILRGHIDFASDPWPSISSSAKDLVKKMLRADPKERLSAVEVLN 319 >gb|ESW32118.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris] Length = 519 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = +3 Query: 6 E*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 E GIF++ILRG++D S PWPSIS SAKDLVKKMLR DPKERLSA+E L+ Sbjct: 271 EQGIFDAILRGHIDFASDPWPSISTSAKDLVKKMLRADPKERLSAVEVLN 320 >ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 [Glycine max] Length = 505 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = +3 Query: 6 E*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 E GIF++ILRG++D S PWPSIS SAKDLVKKMLR DPK+RLSA+E L+ Sbjct: 260 EQGIFDAILRGHIDFASDPWPSISSSAKDLVKKMLRADPKQRLSAVEVLN 309 >ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus trichocarpa] gi|222845258|gb|EEE82805.1| calcium-dependent protein kinase 1 [Populus trichocarpa] Length = 515 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 TE IF+SILRG++D +S PWPSIS SAKDLVK+MLR DPKER+SA+E L+ Sbjct: 269 TEQAIFDSILRGHIDFSSDPWPSISSSAKDLVKQMLRADPKERISAVEVLN 319 >gb|AFW81270.1| putative calcium-dependent protein kinase family protein isoform 1 [Zea mays] gi|413948622|gb|AFW81271.1| putative calcium-dependent protein kinase family protein isoform 2 [Zea mays] Length = 539 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 6 E*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 E GIF+++LRG++D S PWPSIS SAKDLVKKMLR+DPKERL+A E L+ Sbjct: 292 EDGIFDAVLRGHIDFASDPWPSISNSAKDLVKKMLRQDPKERLTAAEILN 341 >gb|AFW81269.1| putative calcium-dependent protein kinase family protein [Zea mays] Length = 478 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 6 E*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 E GIF+++LRG++D S PWPSIS SAKDLVKKMLR+DPKERL+A E L+ Sbjct: 292 EDGIFDAVLRGHIDFASDPWPSISNSAKDLVKKMLRQDPKERLTAAEILN 341 >ref|XP_002441592.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor] gi|241946877|gb|EES20022.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor] Length = 541 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 6 E*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 E GIF+++LRG++D S PWPSIS SAKDLVKKMLR+DPKERL+A E L+ Sbjct: 294 EDGIFDAVLRGHIDFASDPWPSISNSAKDLVKKMLRQDPKERLTAAEILN 343 >gb|ESW32622.1| hypothetical protein PHAVU_001G003300g [Phaseolus vulgaris] Length = 380 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEAL 152 T+ GIF+SIL G LDL SAPWPSIS +AKDL++KML RDPK+R++A EAL Sbjct: 277 TQRGIFDSILEGKLDLESAPWPSISAAAKDLIRKMLTRDPKKRITAAEAL 326 >gb|ESW32615.1| hypothetical protein PHAVU_001G002800g [Phaseolus vulgaris] Length = 789 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEAL 152 TE GIF++IL G LDL SAPWPSIS +AKDL++KML RDPK+R++A EAL Sbjct: 542 TERGIFDTILEGKLDLESAPWPSISAAAKDLIRKMLTRDPKKRITAAEAL 591 >ref|XP_006446309.1| hypothetical protein CICLE_v10014854mg [Citrus clementina] gi|557548920|gb|ESR59549.1| hypothetical protein CICLE_v10014854mg [Citrus clementina] Length = 534 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 +E GIFN+ILRG++D TS PWPSIS AKDLVKKML DPK+RL+A E L+ Sbjct: 285 SEHGIFNAILRGHIDFTSDPWPSISPQAKDLVKKMLNSDPKQRLTATEVLA 335 >ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] gi|557541705|gb|ESR52683.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] Length = 520 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 TE IF++ILRG++D +S PWP+IS SAKD+VKKMLR DPKERLSA E L+ Sbjct: 273 TEQSIFDAILRGHIDFSSDPWPNISSSAKDIVKKMLRADPKERLSAAEVLN 323 >ref|XP_006439442.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] gi|557541704|gb|ESR52682.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] Length = 420 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 TE IF++ILRG++D +S PWP+IS SAKD+VKKMLR DPKERLSA E L+ Sbjct: 273 TEQSIFDAILRGHIDFSSDPWPNISSSAKDIVKKMLRADPKERLSAAEVLN 323 >ref|XP_006439441.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] gi|557541703|gb|ESR52681.1| hypothetical protein CICLE_v10019724mg [Citrus clementina] Length = 397 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 TE IF++ILRG++D +S PWP+IS SAKD+VKKMLR DPKERLSA E L+ Sbjct: 273 TEQSIFDAILRGHIDFSSDPWPNISSSAKDIVKKMLRADPKERLSAAEVLN 323 >gb|EOY32872.1| Calcium-dependent protein kinase 17 [Theobroma cacao] Length = 535 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 +E GIFN+ILRG++D TS PWPSIS AKDLV+KML DPK+RL+A++ LS Sbjct: 285 SEHGIFNAILRGHIDFTSDPWPSISHQAKDLVRKMLNSDPKQRLTAIQVLS 335 >gb|EOY24889.1| Calcium-dependent protein kinase 6 isoform 2 [Theobroma cacao] Length = 476 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 TE IF+SILRGN+D +S PWPS+S SAKDLV+KML DPKERLSA E L+ Sbjct: 284 TEQSIFDSILRGNIDFSSDPWPSVSSSAKDLVRKMLLDDPKERLSASEVLN 334 >gb|EOY24888.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao] Length = 531 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +3 Query: 3 TE*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALS 155 TE IF+SILRGN+D +S PWPS+S SAKDLV+KML DPKERLSA E L+ Sbjct: 284 TEQSIFDSILRGNIDFSSDPWPSVSSSAKDLVRKMLLDDPKERLSASEVLN 334 >ref|XP_003567833.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 3 [Brachypodium distachyon] Length = 514 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/57 (59%), Positives = 47/57 (82%) Frame = +3 Query: 6 E*GIFNSILRGNLDLTSAPWPSISKSAKDLVKKMLRRDPKERLSALEALSKFLYAIS 176 E GIF+++L+G++D +S PWPSIS AKDLV++MLR+DPKERL+A E LSK L ++ Sbjct: 301 EDGIFDAVLQGHIDFSSDPWPSISHGAKDLVRRMLRQDPKERLTAAEILSKSLQIVA 357