BLASTX nr result
ID: Achyranthes23_contig00056023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00056023 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298039.1| predicted protein [Populus trichocarpa] 70 4e-10 ref|XP_002509785.1| glutathione-s-transferase theta, gst, putati... 67 2e-09 ref|XP_006439583.1| hypothetical protein CICLE_v10021831mg [Citr... 65 1e-08 emb|CBI34681.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002272455.1| PREDICTED: glutathione S-transferase T1 [Vit... 65 1e-08 ref|XP_006476596.1| PREDICTED: glutathione S-transferase T1-like... 64 2e-08 ref|NP_001236903.1| glutathione S-transferase GST 23 [Glycine ma... 64 3e-08 gb|AAF64449.1|AF239927_1 glutathione S-transferase [Euphorbia es... 64 3e-08 gb|AFK36240.1| unknown [Lotus japonicus] 64 3e-08 ref|XP_002298040.2| glutathione S-transferase family protein [Po... 63 5e-08 ref|XP_004245615.1| PREDICTED: glutathione S-transferase T1-like... 63 5e-08 gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populu... 63 5e-08 ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citr... 62 8e-08 ref|XP_004298759.1| PREDICTED: glutathione S-transferase T1-like... 62 8e-08 gb|AEB77874.1| glutathione S-transferase protein [Bruguiera gymn... 62 8e-08 ref|XP_002304489.1| glutathione S-transferase family protein [Po... 62 8e-08 gb|ACC93946.1| glutathione S-transferase [Panax ginseng] 62 8e-08 gb|AFK47457.1| unknown [Medicago truncatula] 61 1e-07 ref|XP_003630524.1| Glutathione transferase [Medicago truncatula... 61 2e-07 gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populu... 60 2e-07 >ref|XP_002298039.1| predicted protein [Populus trichocarpa] Length = 95 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 LLC ++ +Q +DE E I GPFKKVQ+WIED KNATRPHFD+VH+ L Sbjct: 37 LLCEIMQLQFVDETESNHILGPFKKVQQWIEDTKNATRPHFDEVHQTL 84 >ref|XP_002509785.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] gi|223549684|gb|EEF51172.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] Length = 250 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/58 (53%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLLFEDRPRFRE 199 L+C ++ ++VLDE++ I GP KKVQ+WIEDIK TRPHFD+VHK +LF + R ++ Sbjct: 172 LVCEIMQLEVLDEKDCNRILGPHKKVQQWIEDIKRVTRPHFDEVHK-VLFRAKARLQK 228 >ref|XP_006439583.1| hypothetical protein CICLE_v10021831mg [Citrus clementina] gi|557541845|gb|ESR52823.1| hypothetical protein CICLE_v10021831mg [Citrus clementina] Length = 252 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 2/66 (3%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLL-FEDRPRFREA 202 L+C ++ +++LDEE++ + GP KKVQEWIE + ATRPHFD+VHK L ++ + R+ Sbjct: 172 LVCEIMELELLDEEDRTRLLGPHKKVQEWIESTRRATRPHFDEVHKVLFKVKENLQKRQL 231 Query: 203 VGRSAT 220 +G A+ Sbjct: 232 LGTGAS 237 >emb|CBI34681.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/58 (50%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLLFEDRPRFRE 199 L+C ++ +++L + E+ I GP+KKVQ+WIE+ KNATRPHFD+VH LLF + R ++ Sbjct: 172 LVCEIMQLEILGDRERNRILGPYKKVQQWIENTKNATRPHFDEVHA-LLFGFKARLQK 228 >ref|XP_002272455.1| PREDICTED: glutathione S-transferase T1 [Vitis vinifera] Length = 248 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/58 (50%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLLFEDRPRFRE 199 L+C ++ +++L + E+ I GP+KKVQ+WIE+ KNATRPHFD+VH LLF + R ++ Sbjct: 172 LVCEIMQLEILGDRERNRILGPYKKVQQWIENTKNATRPHFDEVHA-LLFGFKARLQK 228 >ref|XP_006476596.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis] Length = 252 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 L+C ++ +++LDEE++ + GP KKVQEWIE + ATRPHFD+VHK L Sbjct: 172 LVCEIMELELLDEEDRTRLLGPHKKVQEWIESTRRATRPHFDEVHKVL 219 >ref|NP_001236903.1| glutathione S-transferase GST 23 [Glycine max] gi|11385461|gb|AAG34813.1|AF243378_1 glutathione S-transferase GST 23 [Glycine max] Length = 250 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 1/64 (1%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLLFEDRPRFREAV 205 L+C ++ +++LDE+++ I GP KKVQ+WIE +NATRPHFD+VH +L++ + R E Sbjct: 172 LVCEIMQLELLDEKDRDRILGPHKKVQQWIESTRNATRPHFDEVHT-ILYKLKTRLSEQQ 230 Query: 206 GRSA 217 A Sbjct: 231 SNQA 234 >gb|AAF64449.1|AF239927_1 glutathione S-transferase [Euphorbia esula] Length = 238 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/48 (56%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 L+C ++ ++ L+E+++K I GPFKKVQ+WIED K AT PHFD+VH+ L Sbjct: 172 LVCELMQLEFLEEDDRKRILGPFKKVQQWIEDTKIATNPHFDEVHETL 219 >gb|AFK36240.1| unknown [Lotus japonicus] Length = 251 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 L+C ++ +++LDE+++ I GP KKVQ+WIE KNATRPHFD+VH L Sbjct: 173 LVCEIMQLELLDEKDRDRILGPHKKVQQWIESTKNATRPHFDEVHNVL 220 >ref|XP_002298040.2| glutathione S-transferase family protein [Populus trichocarpa] gi|550346875|gb|EEE82845.2| glutathione S-transferase family protein [Populus trichocarpa] Length = 247 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/58 (48%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLLFEDRPRFRE 199 L+C ++ ++VLDE++ I P+KKVQ+W+ED KNATRPHFD+VH+ +LF+ + + ++ Sbjct: 172 LVCELMQLEVLDEKDCSRILCPYKKVQQWMEDTKNATRPHFDEVHQ-ILFKAKVKLQK 228 >ref|XP_004245615.1| PREDICTED: glutathione S-transferase T1-like [Solanum lycopersicum] Length = 250 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/72 (43%), Positives = 50/72 (69%), Gaps = 4/72 (5%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLLFEDRPRF---R 196 L+C ++ +++LDE++++ I GP+K+V +WI+D KNA PHF +VH +LF+ + +F R Sbjct: 172 LVCEIMELEILDEKDRERIIGPYKRVLKWIDDTKNAMEPHFQEVHV-ILFKAKEKFHKQR 230 Query: 197 EAVGRSAT*SCR 232 AVG S S R Sbjct: 231 HAVGSSIPQSSR 242 >gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populus trichocarpa] Length = 247 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/58 (48%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLLFEDRPRFRE 199 L+C ++ ++VLDE++ I P+KKVQ+W+ED KNATRPHFD+VH+ +LF+ + + ++ Sbjct: 172 LVCELMQLEVLDEKDCSRILCPYKKVQQWMEDTKNATRPHFDEVHQ-ILFKAKVKLQK 228 >ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citrus clementina] gi|568845464|ref|XP_006476593.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis] gi|557541844|gb|ESR52822.1| hypothetical protein CICLE_v10021879mg [Citrus clementina] Length = 247 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 L+C + +++LDEE++ + GP KKVQ+WIE KNATRPHFD+VH+ L Sbjct: 172 LVCETMQLELLDEEDRIGLMGPHKKVQQWIESTKNATRPHFDEVHEVL 219 >ref|XP_004298759.1| PREDICTED: glutathione S-transferase T1-like [Fragaria vesca subsp. vesca] Length = 252 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/58 (46%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLLFEDRPRFRE 199 L+C ++ +++LDE ++ I P KKV +WIE+ KNATRPHF++VH+ +L+ + RF+E Sbjct: 172 LVCEIMQLELLDENDRSRILDPHKKVLQWIENTKNATRPHFEEVHQ-ILYRAKTRFQE 228 >gb|AEB77874.1| glutathione S-transferase protein [Bruguiera gymnorhiza] Length = 250 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 L+C ++ +++LD++++ + GP KKVQ+WIE K ATRPHFD+VHK L Sbjct: 172 LVCELMQLEILDDKDRNRLLGPHKKVQQWIESTKKATRPHFDEVHKTL 219 >ref|XP_002304489.1| glutathione S-transferase family protein [Populus trichocarpa] gi|222841921|gb|EEE79468.1| glutathione S-transferase family protein [Populus trichocarpa] Length = 232 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 L+C ++ ++ DE ++ I GP KK+Q+WIED KNAT+PHFD+VH+ L Sbjct: 173 LVCEIMQLEFTDETDRNRILGPHKKIQQWIEDTKNATKPHFDEVHQAL 220 >gb|ACC93946.1| glutathione S-transferase [Panax ginseng] Length = 250 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/58 (46%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHLLFEDRPRFRE 199 L+C ++ +++LDE ++ I GP KKV +W+ED K ATRPHFD++H+ LLF+ + + E Sbjct: 172 LVCEIMQLELLDERDRDRILGPHKKVLQWVEDTKKATRPHFDEIHE-LLFKLKAKLAE 228 >gb|AFK47457.1| unknown [Medicago truncatula] Length = 250 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 L+C ++ +Q+LDE++ I GP+KKVQ+WIE KNAT+PHF +VH L Sbjct: 172 LVCEIMQLQLLDEKDHDRILGPYKKVQQWIESTKNATKPHFHEVHNVL 219 >ref|XP_003630524.1| Glutathione transferase [Medicago truncatula] gi|355524546|gb|AET05000.1| Glutathione transferase [Medicago truncatula] Length = 250 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 L+C ++ +Q+LDE++ I GP+KKVQ+W+E KNAT+PHF +VH L Sbjct: 172 LVCEIMQLQLLDEKDHDRILGPYKKVQQWVESTKNATKPHFHEVHNVL 219 >gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populus trichocarpa] Length = 232 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +2 Query: 29 LLCNVI-IQVLDEEEKKEIFGPFKKVQEWIEDIKNATRPHFDDVHKHL 169 L+C ++ ++ DE ++ I GP KK+Q+WIED KNAT+PHFD+VH+ L Sbjct: 173 LVCEIMQLEFTDETDRNCILGPHKKIQQWIEDTKNATKPHFDEVHQAL 220