BLASTX nr result
ID: Achyranthes23_contig00056008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00056008 (264 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534238.1| PREDICTED: dirigent protein 1-like [Glycine ... 62 8e-08 ref|XP_003629142.1| Disease resistance response protein [Medicag... 58 2e-06 ref|XP_003629148.1| Disease resistance response protein [Medicag... 58 2e-06 gb|EMJ04058.1| hypothetical protein PRUPE_ppa015438mg, partial [... 57 2e-06 gb|AFK48041.1| unknown [Lotus japonicus] 56 4e-06 ref|XP_004509433.1| PREDICTED: uncharacterized protein LOC101488... 55 1e-05 >ref|XP_003534238.1| PREDICTED: dirigent protein 1-like [Glycine max] Length = 186 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -1 Query: 264 DFLFVQGFLSLSLFDAKGLSFVYKLEVHLYWPPYAAQA 151 DF+FVQG++S S D KGL+ VYK+E HLYWPPYA QA Sbjct: 148 DFMFVQGYISTSPVDLKGLTVVYKIEFHLYWPPYATQA 185 >ref|XP_003629142.1| Disease resistance response protein [Medicago truncatula] gi|355523164|gb|AET03618.1| Disease resistance response protein [Medicago truncatula] Length = 190 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -1 Query: 264 DFLFVQGFLSLSLFDAKGLSFVYKLEVHLYWPPYAAQA 151 DF+FVQG+++ S D KGL+ VYK+E H+YWPPYA Q+ Sbjct: 152 DFMFVQGYVTSSPVDLKGLTVVYKIEFHIYWPPYAIQS 189 >ref|XP_003629148.1| Disease resistance response protein [Medicago truncatula] gi|355523170|gb|AET03624.1| Disease resistance response protein [Medicago truncatula] Length = 190 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -1 Query: 264 DFLFVQGFLSLSLFDAKGLSFVYKLEVHLYWPPYAAQA 151 DF+FVQG+++ S D KGL+ VYK+E H+YWPPYA Q+ Sbjct: 152 DFMFVQGYVTSSPVDLKGLTVVYKIEFHIYWPPYAIQS 189 >gb|EMJ04058.1| hypothetical protein PRUPE_ppa015438mg, partial [Prunus persica] Length = 160 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 264 DFLFVQGFLSLSLFDAKGLSFVYKLEVHLYWPPYAAQ 154 DFLFVQG+++ S + KGL+ VYK+E HLYWPPYA Q Sbjct: 122 DFLFVQGYVTSSPVNLKGLTVVYKIEFHLYWPPYATQ 158 >gb|AFK48041.1| unknown [Lotus japonicus] Length = 188 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -1 Query: 264 DFLFVQGFLSLSLFDAKGLSFVYKLEVHLYWPPYAAQA 151 DFLFVQG+++ S D KG++ YK+E HLYWPPYA A Sbjct: 150 DFLFVQGYVTSSPVDLKGVTVTYKIEFHLYWPPYATHA 187 >ref|XP_004509433.1| PREDICTED: uncharacterized protein LOC101488686 [Cicer arietinum] Length = 187 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/35 (60%), Positives = 29/35 (82%) Frame = -1 Query: 264 DFLFVQGFLSLSLFDAKGLSFVYKLEVHLYWPPYA 160 DF+FVQG+++ S D KG++ VYK+E H+YWPPYA Sbjct: 149 DFMFVQGYVTSSPVDLKGITVVYKIEFHIYWPPYA 183