BLASTX nr result
ID: Achyranthes23_contig00055421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00055421 (377 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318506.1| hypothetical protein POPTR_0012s00390g [Popu... 53 8e-06 gb|ABK95861.1| unknown [Populus trichocarpa] 53 8e-06 >ref|XP_002318506.1| hypothetical protein POPTR_0012s00390g [Populus trichocarpa] gi|222859179|gb|EEE96726.1| hypothetical protein POPTR_0012s00390g [Populus trichocarpa] Length = 100 Score = 53.1 bits (126), Expect(2) = 8e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 246 KKRNEELEKRLMESLKREERLKGELQRVWDRVRVA 350 KKRNEELEK L ES +REE++K ELQR W+R++VA Sbjct: 16 KKRNEELEKALKESKQREEKMKSELQRAWERLQVA 50 Score = 21.9 bits (45), Expect(2) = 8e-06 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 343 EWLCTQLGELE 375 E LC+QLGELE Sbjct: 55 ERLCSQLGELE 65 >gb|ABK95861.1| unknown [Populus trichocarpa] Length = 100 Score = 53.1 bits (126), Expect(2) = 8e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 246 KKRNEELEKRLMESLKREERLKGELQRVWDRVRVA 350 KKRNEELEK L ES +REE++K ELQR W+R++VA Sbjct: 16 KKRNEELEKALKESKQREEKMKSELQRAWERLQVA 50 Score = 21.9 bits (45), Expect(2) = 8e-06 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 343 EWLCTQLGELE 375 E LC+QLGELE Sbjct: 55 ERLCSQLGELE 65