BLASTX nr result
ID: Achyranthes23_contig00055066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00055066 (284 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFU34589.1| ammonium transporter 1;1 [Alternanthera philoxero... 57 2e-09 ref|XP_002518202.1| ammonium transporter, putative [Ricinus comm... 52 1e-05 >gb|AFU34589.1| ammonium transporter 1;1 [Alternanthera philoxeroides] Length = 513 Score = 57.4 bits (137), Expect(2) = 2e-09 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 15/58 (25%) Frame = +2 Query: 149 PQSSDPFGAASYI----------LTST-----STFLLF*AYLVFSMQLGFAMLCAGSV 277 P +S+PF AASYI T+T S FLLF AYLVFSMQLGFAMLCAGSV Sbjct: 21 PYTSNPFAAASYICSRFATTSSHFTTTTYAIDSAFLLFSAYLVFSMQLGFAMLCAGSV 78 Score = 30.0 bits (66), Expect(2) = 2e-09 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 106 YCSTEELVKYLGPNTS 153 YCST+EL KY GP TS Sbjct: 9 YCSTDELSKYFGPYTS 24 >ref|XP_002518202.1| ammonium transporter, putative [Ricinus communis] gi|223542798|gb|EEF44335.1| ammonium transporter, putative [Ricinus communis] Length = 502 Score = 52.4 bits (124), Expect(2) = 1e-05 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +2 Query: 155 SSDPFGAASYILTSTSTFLLF*AYLVFSMQLGFAMLCAGSV 277 S D F A Y + +T +LLF AYLVFSMQLGFAMLCAGSV Sbjct: 36 SDDNFAATRYAVDNT--YLLFSAYLVFSMQLGFAMLCAGSV 74 Score = 22.3 bits (46), Expect(2) = 1e-05 Identities = 11/18 (61%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Frame = +1 Query: 109 CSTEELVKYLGPN-TSEL 159 CS EL + LGPN TS L Sbjct: 6 CSANELAQLLGPNITSSL 23