BLASTX nr result
ID: Achyranthes23_contig00054920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00054920 (439 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514069.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002514069.1| conserved hypothetical protein [Ricinus communis] gi|223546525|gb|EEF48023.1| conserved hypothetical protein [Ricinus communis] Length = 394 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/93 (37%), Positives = 50/93 (53%), Gaps = 12/93 (12%) Frame = +1 Query: 1 KRVKTPSFSSILLDAVYRSIDEDGG------------DYPRTTPTSPTHNIMKQRDFEID 144 +R +TPSFSS LLDA+YRSIDE G Y TT ++K++ Sbjct: 16 QRKRTPSFSSSLLDAIYRSIDESNGGAGCGEEEVLSQQYQETT-------VIKKQSTRTQ 68 Query: 145 ASKLVQRRTKMRSDSTLETLDLRRAVMIESWME 243 + ++R T + + L T LRRA+++ESWME Sbjct: 69 SVSTIRRDTCLEQEKDLST--LRRAILLESWME 99