BLASTX nr result
ID: Achyranthes23_contig00054843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00054843 (319 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301517.1| PREDICTED: cytochrome P450 71A8-like [Fragar... 57 2e-06 >ref|XP_004301517.1| PREDICTED: cytochrome P450 71A8-like [Fragaria vesca subsp. vesca] Length = 307 Score = 57.0 bits (136), Expect = 2e-06 Identities = 39/95 (41%), Positives = 50/95 (52%), Gaps = 11/95 (11%) Frame = +1 Query: 58 FMHSRVMKEL-DEVRKIVGGK----------GCRYVRLI*RK*CIQKQEF*EAHRMHPPG 204 F H VMK+L +EVR IVG K G Y++ + + E R+HPP Sbjct: 121 FKHPSVMKKLQNEVRGIVGNKQNIITEDDLGGMNYLKAVIK----------ETLRLHPPA 170 Query: 205 QLLFFCESLQDANVNGFDIVIGALVIVDAWLIQRD 309 LLF + QDA VNG++I G LV V+AW I RD Sbjct: 171 PLLFPRMASQDATVNGYNIKRGTLVFVNAWKIGRD 205