BLASTX nr result
ID: Achyranthes23_contig00054829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00054829 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_063999.1| orf100a gene product (mitochondrion) [Beta vulg... 53 4e-09 >ref|NP_063999.1| orf100a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435156|ref|YP_004222374.1| hypothetical protein BevumaM_p141 [Beta vulgaris subsp. maritima] gi|346683248|ref|YP_004842180.1| hypothetical protein BemaM_p136 [Beta macrocarpa] gi|9049301|dbj|BAA99311.1| orf100a [Beta vulgaris subsp. vulgaris] gi|317905607|emb|CBJ14013.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439889|emb|CBJ17589.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148044|emb|CBJ20707.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500166|emb|CBX24985.1| hypothetical protein [Beta macrocarpa] gi|384977908|emb|CBL54132.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 100 Score = 53.1 bits (126), Expect(2) = 4e-09 Identities = 24/50 (48%), Positives = 36/50 (72%) Frame = +2 Query: 2 GNRGLLSNVKSLIKPAKMGLPDGSTKTMIEIGGVNLSDKVRLVEVLHIPD 151 GN+ ++SNV++L K ++GLPDGS KT+ E+G V +S V L VL++ D Sbjct: 24 GNKEIMSNVRTLRKEIRVGLPDGSVKTVNEVGNVKISPNVTLTGVLYVND 73 Score = 33.1 bits (74), Expect(2) = 4e-09 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +3 Query: 153 YKHNLLSVSKLLETNNYRVI 212 +KHNLLSVSKLLE+ N R++ Sbjct: 74 FKHNLLSVSKLLESRNLRLL 93