BLASTX nr result
ID: Achyranthes23_contig00054800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00054800 (216 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274482.1| PREDICTED: phosphatidylinositol 4-kinase bet... 55 7e-06 >ref|XP_002274482.1| PREDICTED: phosphatidylinositol 4-kinase beta 1-like [Vitis vinifera] Length = 1092 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = -3 Query: 142 NESFNDEDKVHANGDEKDTSDFPLFRRFFRVHPEEAKTMAVDAN 11 N+ DE+K +ANG+E+D SDF LFR+ FRVHPE+AK + N Sbjct: 398 NDRTEDEEKGNANGEEEDPSDFSLFRKLFRVHPEDAKVSLANEN 441