BLASTX nr result
ID: Achyranthes23_contig00054742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00054742 (212 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 73 3e-11 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 73.2 bits (178), Expect = 3e-11 Identities = 37/70 (52%), Positives = 48/70 (68%) Frame = +1 Query: 1 LASINMIESAERWVVSYLSVRNHVSRDDFLCDLYARFRDESYGSDVENFNKLEHKTILES 180 LAS+NM++ AE WV SYL R V +DF+ D+ +RF+DES + VE FNKL+ LE Sbjct: 69 LASLNMVDKAENWVSSYLINRTAVDWNDFVIDVNSRFKDESGINVVEEFNKLQQTNSLED 128 Query: 181 YIDEFENHRS 210 YIDEFE +S Sbjct: 129 YIDEFEKVKS 138