BLASTX nr result
ID: Achyranthes23_contig00054423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00054423 (253 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146737.1| PREDICTED: putative glycerol-3-phosphate tra... 73 3e-11 ref|XP_002532502.1| Regulatory protein uhpC, putative [Ricinus c... 69 8e-10 ref|XP_003533881.1| PREDICTED: putative glycerol-3-phosphate tra... 68 1e-09 ref|XP_006350066.1| PREDICTED: putative glycerol-3-phosphate tra... 67 2e-09 ref|XP_004251776.1| PREDICTED: putative glycerol-3-phosphate tra... 66 4e-09 ref|XP_003546598.1| PREDICTED: putative glycerol-3-phosphate tra... 64 2e-08 gb|EXB79363.1| Putative glycerol-3-phosphate transporter 5 [Moru... 64 3e-08 gb|EOY31286.1| Major facilitator superfamily protein isoform 1 [... 64 3e-08 ref|XP_006409692.1| hypothetical protein EUTSA_v10022662mg [Eutr... 63 4e-08 ref|XP_002324576.1| glycerol-3-phosphate transporter family prot... 63 5e-08 gb|ESW10444.1| hypothetical protein PHAVU_009G210000g [Phaseolus... 62 1e-07 ref|XP_006473938.1| PREDICTED: putative glycerol-3-phosphate tra... 61 1e-07 ref|XP_006453716.1| hypothetical protein CICLE_v10008087mg [Citr... 61 1e-07 ref|XP_004502997.1| PREDICTED: putative glycerol-3-phosphate tra... 61 1e-07 gb|EMJ03149.1| hypothetical protein PRUPE_ppa004556mg [Prunus pe... 61 1e-07 ref|XP_002267328.2| PREDICTED: putative glycerol-3-phosphate tra... 59 5e-07 emb|CBI25588.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|NP_178954.2| putative glycerol-3-phosphate transporter 5 [Ar... 59 9e-07 ref|NP_001154513.1| putative glycerol-3-phosphate transporter 5 ... 59 9e-07 ref|NP_001154514.1| putative glycerol-3-phosphate transporter 5 ... 59 9e-07 >ref|XP_004146737.1| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Cucumis sativus] gi|449505417|ref|XP_004162463.1| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Cucumis sativus] Length = 512 Score = 73.2 bits (178), Expect = 3e-11 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = -3 Query: 173 PCLVFLPKALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSNPL 12 PCL + L FH+ L+LTITFFAY S HASRKPPSIVKSVLGP I VN S L Sbjct: 15 PCLKPPHRTLDFHRILVLTITFFAYASFHASRKPPSIVKSVLGPTIPVNSSTIL 68 >ref|XP_002532502.1| Regulatory protein uhpC, putative [Ricinus communis] gi|223527777|gb|EEF29878.1| Regulatory protein uhpC, putative [Ricinus communis] Length = 473 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 6/58 (10%) Frame = -3 Query: 176 PPCLVFLP------KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGS 21 PP L P K + FHK L+L ITF AY S HASRKPPSIVKSVLGP I +N S Sbjct: 4 PPALYLFPSLNPPHKTIAFHKYLVLLITFLAYASFHASRKPPSIVKSVLGPNIQLNSS 61 >ref|XP_003533881.1| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Glycine max] Length = 493 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/62 (54%), Positives = 39/62 (62%), Gaps = 6/62 (9%) Frame = -3 Query: 173 PCLVFLP------KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSNPL 12 P L F P K L FH+ +L ITF AY S HASRKPPSIVKSVLGP + NG+ + Sbjct: 10 PALTFFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIVKSVLGPTVPSNGTQVV 69 Query: 11 QD 6 D Sbjct: 70 SD 71 >ref|XP_006350066.1| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Solanum tuberosum] Length = 506 Score = 67.0 bits (162), Expect = 2e-09 Identities = 36/57 (63%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -3 Query: 185 HNSPPCLVFLPKALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISV-NGSN 18 HN P L K L FHK L+L +TF AY +LHASRKPPSIVKSVLGPEI NG++ Sbjct: 19 HNLFPTLNPPEKTLTFHKFLVLFLTFIAYAALHASRKPPSIVKSVLGPEIKAHNGTD 75 >ref|XP_004251776.1| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Solanum lycopersicum] Length = 506 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 185 HNSPPCLVFLPKALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEI-SVNGSN 18 HN P L K L FHK L+L +TF AY + HASRKPPSIVKSVLGPEI ++NG++ Sbjct: 19 HNLFPTLNPPEKTLTFHKFLVLFLTFIAYAAFHASRKPPSIVKSVLGPEIKALNGTD 75 >ref|XP_003546598.1| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Glycine max] Length = 492 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 6/57 (10%) Frame = -3 Query: 173 PCLVFLP------KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGS 21 P L P K L FH+ +L ITF AY S HASRKPPSIVKSVLGP + NG+ Sbjct: 10 PALTLFPGLKPPHKTLLFHQICVLVITFLAYASFHASRKPPSIVKSVLGPTVPSNGT 66 >gb|EXB79363.1| Putative glycerol-3-phosphate transporter 5 [Morus notabilis] Length = 524 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/57 (61%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Frame = -3 Query: 173 PCLVFLP------KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGS 21 P L FLP K L FH+ L +TF AY S HASRKPPSIVKSVLGP+IS N S Sbjct: 10 PGLNFLPSLKPPNKTLAFHQISALILTFLAYASFHASRKPPSIVKSVLGPKISSNSS 66 >gb|EOY31286.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] gi|508784031|gb|EOY31287.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] Length = 497 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/59 (54%), Positives = 38/59 (64%) Frame = -3 Query: 194 MMPHNSPPCLVFLPKALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSN 18 ++P PP K L FH+ LI +TF AY S HASRKPPSIVKS+LGP I N S+ Sbjct: 14 LLPTLKPP-----HKTLIFHQILIFILTFLAYASFHASRKPPSIVKSILGPTIQSNSSS 67 >ref|XP_006409692.1| hypothetical protein EUTSA_v10022662mg [Eutrema salsugineum] gi|557110854|gb|ESQ51145.1| hypothetical protein EUTSA_v10022662mg [Eutrema salsugineum] Length = 487 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -3 Query: 164 VFLPKALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGS 21 +F K FH+ L+L ITF AY S HASRKPPSIVKSVLGP + N S Sbjct: 12 LFSHKTFSFHQILVLIITFIAYASFHASRKPPSIVKSVLGPSVRSNSS 59 >ref|XP_002324576.1| glycerol-3-phosphate transporter family protein [Populus trichocarpa] gi|222866010|gb|EEF03141.1| glycerol-3-phosphate transporter family protein [Populus trichocarpa] Length = 506 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/58 (55%), Positives = 37/58 (63%) Frame = -3 Query: 194 MMPHNSPPCLVFLPKALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGS 21 + P PP K L FH+ +L ITF AY S HASRKPPSIVK VLGP+I +N S Sbjct: 14 LFPSLKPP-----NKTLTFHQFTVLAITFLAYASFHASRKPPSIVKGVLGPKIQLNSS 66 >gb|ESW10444.1| hypothetical protein PHAVU_009G210000g [Phaseolus vulgaris] Length = 492 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/64 (51%), Positives = 38/64 (59%) Frame = -3 Query: 212 QTYNTIMMPHNSPPCLVFLPKALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEIS 33 QT + P PP K L FH+ +L ITF AY S HASRKPPSIVKSVLGP + Sbjct: 8 QTPALKLFPGLKPP-----HKTLLFHQICVLVITFLAYASFHASRKPPSIVKSVLGPTVP 62 Query: 32 VNGS 21 N + Sbjct: 63 SNAT 66 >ref|XP_006473938.1| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Citrus sinensis] Length = 497 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -3 Query: 152 KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSN 18 K L FH+ L ITFFAY S HASRKPPSIVKSVLGP + +GSN Sbjct: 27 KTLIFHQITALVITFFAYASFHASRKPPSIVKSVLGP--TFDGSN 69 >ref|XP_006453716.1| hypothetical protein CICLE_v10008087mg [Citrus clementina] gi|557556942|gb|ESR66956.1| hypothetical protein CICLE_v10008087mg [Citrus clementina] Length = 497 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -3 Query: 152 KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSN 18 K L FH+ L ITFFAY S HASRKPPSIVKSVLGP + +GSN Sbjct: 27 KTLIFHQITALVITFFAYASFHASRKPPSIVKSVLGP--TFDGSN 69 >ref|XP_004502997.1| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Cicer arietinum] Length = 502 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -3 Query: 152 KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVN 27 K L FH+ +L ITF AY S HASRKPPSIVKSVLGP + N Sbjct: 25 KTLLFHQICVLVITFLAYASFHASRKPPSIVKSVLGPTLPTN 66 >gb|EMJ03149.1| hypothetical protein PRUPE_ppa004556mg [Prunus persica] Length = 503 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/58 (56%), Positives = 37/58 (63%), Gaps = 6/58 (10%) Frame = -3 Query: 173 PCLVFLP------KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSN 18 P L + P K L FH+ +L ITF AY S HASRKPPSIVKSVLGP I N S+ Sbjct: 10 PALNYFPTLKPPHKTLAFHQFSVLIITFLAYASFHASRKPPSIVKSVLGPTIQSNTSS 67 >ref|XP_002267328.2| PREDICTED: putative glycerol-3-phosphate transporter 5-like [Vitis vinifera] Length = 490 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -3 Query: 152 KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSN 18 K L FH+ L ITF AY S HASRKPPSIVKSVL PEI N ++ Sbjct: 23 KTLTFHRISALLITFVAYASFHASRKPPSIVKSVLSPEIQSNSTS 67 >emb|CBI25588.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -3 Query: 152 KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSN 18 K L FH+ L ITF AY S HASRKPPSIVKSVL PEI N ++ Sbjct: 23 KTLTFHRISALLITFVAYASFHASRKPPSIVKSVLSPEIQSNSTS 67 >ref|NP_178954.2| putative glycerol-3-phosphate transporter 5 [Arabidopsis thaliana] gi|317376204|sp|Q9SL56.2|GLPT5_ARATH RecName: Full=Putative glycerol-3-phosphate transporter 5; Short=G-3-P transporter 5; AltName: Full=Glycerol-3-phosphate permease 5; Short=AtG3Pp5; Short=G-3-P permease 5 gi|330251121|gb|AEC06215.1| putative glycerol-3-phosphate transporter 5 [Arabidopsis thaliana] Length = 493 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -3 Query: 152 KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSN 18 K FH+ L+L ITF AY S HASRKPPSIVKSVLGP S+N S+ Sbjct: 23 KTFTFHQILVLIITFTAYASFHASRKPPSIVKSVLGPP-SLNSSS 66 >ref|NP_001154513.1| putative glycerol-3-phosphate transporter 5 [Arabidopsis thaliana] gi|48310446|gb|AAT41822.1| At2g13100 [Arabidopsis thaliana] gi|330251122|gb|AEC06216.1| putative glycerol-3-phosphate transporter 5 [Arabidopsis thaliana] Length = 329 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -3 Query: 152 KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSN 18 K FH+ L+L ITF AY S HASRKPPSIVKSVLGP S+N S+ Sbjct: 23 KTFTFHQILVLIITFTAYASFHASRKPPSIVKSVLGPP-SLNSSS 66 >ref|NP_001154514.1| putative glycerol-3-phosphate transporter 5 [Arabidopsis thaliana] gi|46931240|gb|AAT06424.1| At2g13100 [Arabidopsis thaliana] gi|330251123|gb|AEC06217.1| putative glycerol-3-phosphate transporter 5 [Arabidopsis thaliana] Length = 307 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -3 Query: 152 KALFFHKTLILTITFFAYVSLHASRKPPSIVKSVLGPEISVNGSN 18 K FH+ L+L ITF AY S HASRKPPSIVKSVLGP S+N S+ Sbjct: 23 KTFTFHQILVLIITFTAYASFHASRKPPSIVKSVLGPP-SLNSSS 66