BLASTX nr result
ID: Achyranthes23_contig00054150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00054150 (348 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319269.1| histone 2 [Populus trichocarpa] gi|566154760... 55 7e-06 >ref|XP_002319269.1| histone 2 [Populus trichocarpa] gi|566154760|ref|XP_006370602.1| histone H2A family protein [Populus trichocarpa] gi|550349808|gb|ERP67171.1| histone H2A family protein [Populus trichocarpa] Length = 169 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 10/56 (17%) Frame = -1 Query: 231 EKEKEMAGREKTLGC----------SKAGL*FPMGCIARFLKAGKHTKRVSADAPI 94 +K + MAGR KTLG SKAGL FP+G IARFLKAGK+ +RV A AP+ Sbjct: 31 DKNQSMAGRGKTLGSGASKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPV 86