BLASTX nr result
ID: Achyranthes23_contig00053823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00053823 (420 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001058344.1| Os06g0675200 [Oryza sativa Japonica Group] g... 61 1e-07 gb|EEC81168.1| hypothetical protein OsI_24140 [Oryza sativa Indi... 61 1e-07 gb|EXB42560.1| hypothetical protein L484_011333 [Morus notabilis] 59 7e-07 ref|XP_006656369.1| PREDICTED: putative protein TPRXL-like [Oryz... 58 1e-06 ref|XP_004248355.1| PREDICTED: uncharacterized protein LOC101244... 58 1e-06 ref|XP_002307196.1| hypothetical protein POPTR_0005s10110g [Popu... 58 1e-06 ref|XP_003532942.1| PREDICTED: putative protein TPRXL-like isofo... 57 2e-06 ref|XP_004173073.1| PREDICTED: uncharacterized protein LOC101225... 57 3e-06 ref|XP_004147758.1| PREDICTED: uncharacterized protein LOC101217... 57 3e-06 ref|XP_006352579.1| PREDICTED: uncharacterized protein DDB_G0271... 57 3e-06 gb|EOY13818.1| Uncharacterized protein TCM_032474 [Theobroma cacao] 56 4e-06 ref|XP_004243991.1| PREDICTED: uncharacterized protein LOC101260... 56 4e-06 emb|CBI21800.3| unnamed protein product [Vitis vinifera] 56 4e-06 ref|XP_002270778.1| PREDICTED: uncharacterized protein LOC100259... 56 4e-06 emb|CAN69700.1| hypothetical protein VITISV_003292 [Vitis vinifera] 56 4e-06 gb|EPS64128.1| hypothetical protein M569_10654, partial [Genlise... 56 6e-06 ref|XP_004295696.1| PREDICTED: uncharacterized protein LOC101304... 56 6e-06 gb|EMJ12985.1| hypothetical protein PRUPE_ppa006324mg [Prunus pe... 56 6e-06 ref|XP_002310690.2| hypothetical protein POPTR_0007s08450g [Popu... 55 7e-06 gb|ESW21261.1| hypothetical protein PHAVU_005G055800g [Phaseolus... 55 1e-05 >ref|NP_001058344.1| Os06g0675200 [Oryza sativa Japonica Group] gi|52077432|dbj|BAD46541.1| unknown protein [Oryza sativa Japonica Group] gi|113596384|dbj|BAF20258.1| Os06g0675200 [Oryza sativa Japonica Group] gi|125598220|gb|EAZ38000.1| hypothetical protein OsJ_22345 [Oryza sativa Japonica Group] Length = 412 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -1 Query: 420 AKSTPPPPPQEKSGLTISEDPYLFSPKAPRCSSRWRELLGFKKLNSQQPKITP 262 A S P P + + + DPY+FSPKAP CSSRWRELLG K+ +Q PK +P Sbjct: 122 APSEPMKPLRAATAAVDAADPYVFSPKAPSCSSRWRELLGLKRAAAQSPKPSP 174 >gb|EEC81168.1| hypothetical protein OsI_24140 [Oryza sativa Indica Group] Length = 412 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -1 Query: 420 AKSTPPPPPQEKSGLTISEDPYLFSPKAPRCSSRWRELLGFKKLNSQQPKITP 262 A S P P + + + DPY+FSPKAP CSSRWRELLG K+ +Q PK +P Sbjct: 122 APSEPMKPLRAAAAAVDAADPYVFSPKAPSCSSRWRELLGLKRAAAQSPKPSP 174 >gb|EXB42560.1| hypothetical protein L484_011333 [Morus notabilis] Length = 433 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 411 TPPPPPQEKSGLTISEDPYLFSPKAPRCSSRWRELLGFKKL 289 T P + +S ++ DPYLFSPKAPRCSSRWRELLG K+L Sbjct: 117 TASPDTRRRSEISGRSDPYLFSPKAPRCSSRWRELLGLKRL 157 >ref|XP_006656369.1| PREDICTED: putative protein TPRXL-like [Oryza brachyantha] Length = 413 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = -1 Query: 414 STPPPPPQEKSGLTI-SEDPYLFSPKAPRCSSRWRELLGFKKLNSQQPKITP 262 S P P + + + + DPY+FSPKAP CSSRWRELLG K+ +Q PK +P Sbjct: 125 SEPMKPLRAAAAAAVDATDPYVFSPKAPSCSSRWRELLGLKRAAAQSPKPSP 176 >ref|XP_004248355.1| PREDICTED: uncharacterized protein LOC101244039 [Solanum lycopersicum] Length = 371 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/51 (50%), Positives = 35/51 (68%) Frame = -1 Query: 417 KSTPPPPPQEKSGLTISEDPYLFSPKAPRCSSRWRELLGFKKLNSQQPKIT 265 +S P + ++ +DPYLFSPKAPRCSSRWRE+LG KKL + + + T Sbjct: 99 RSPETPKLRMRNNEISRKDPYLFSPKAPRCSSRWREILGLKKLQNDKHEAT 149 >ref|XP_002307196.1| hypothetical protein POPTR_0005s10110g [Populus trichocarpa] gi|222856645|gb|EEE94192.1| hypothetical protein POPTR_0005s10110g [Populus trichocarpa] Length = 474 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/64 (50%), Positives = 35/64 (54%) Frame = -1 Query: 363 DPYLFSPKAPRCSSRWRELLGFKKLNSQQPKITPXXXXXXXXXXXXXXXXXXXXXXFLNR 184 DPYLFSPKAPRCSSRW+ELLG KKL+ Q PK L+R Sbjct: 156 DPYLFSPKAPRCSSRWKELLGLKKLH-QNPKPETQKPSTRTALFSSSSSNPKSLKHILHR 214 Query: 183 NSKT 172 NSKT Sbjct: 215 NSKT 218 >ref|XP_003532942.1| PREDICTED: putative protein TPRXL-like isoform X1 [Glycine max] gi|571471863|ref|XP_006585430.1| PREDICTED: putative protein TPRXL-like isoform X2 [Glycine max] Length = 354 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/53 (56%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = -1 Query: 414 STPPPPPQEKSGLTISEDPYLFSPKAPRCSSRWRELLGFKKL--NSQQPKITP 262 +T PP S S DPYLFSPKAPRCSSRW++LLG KKL + K TP Sbjct: 73 NTVTPPTTTSSS---SADPYLFSPKAPRCSSRWKDLLGLKKLYQTTNNTKTTP 122 >ref|XP_004173073.1| PREDICTED: uncharacterized protein LOC101225584 [Cucumis sativus] Length = 450 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 369 SEDPYLFSPKAPRCSSRWRELLGFKKL 289 S DPYLFSPKAPRCSSRWRELLG KKL Sbjct: 140 STDPYLFSPKAPRCSSRWRELLGLKKL 166 >ref|XP_004147758.1| PREDICTED: uncharacterized protein LOC101217146 [Cucumis sativus] Length = 450 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 369 SEDPYLFSPKAPRCSSRWRELLGFKKL 289 S DPYLFSPKAPRCSSRWRELLG KKL Sbjct: 140 STDPYLFSPKAPRCSSRWRELLGLKKL 166 >ref|XP_006352579.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Solanum tuberosum] Length = 386 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -1 Query: 417 KSTPPPPPQEKSGLTISEDPYLFSPKAPRCSSRWRELLGFKKLNSQQ 277 +S P + ++ +DPYLFSPKAPRCSSRWRE+LG KKL + + Sbjct: 99 RSPETPKLRMRNNEISRKDPYLFSPKAPRCSSRWREILGLKKLQNDK 145 >gb|EOY13818.1| Uncharacterized protein TCM_032474 [Theobroma cacao] Length = 427 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%) Frame = -1 Query: 363 DPYLFSPKAPRCSSRWRELLGFKK---LNSQQPK 271 DPYLFSPKAPRCSSRWRELLG KK + +Q PK Sbjct: 135 DPYLFSPKAPRCSSRWRELLGLKKFSQITNQPPK 168 >ref|XP_004243991.1| PREDICTED: uncharacterized protein LOC101260742 [Solanum lycopersicum] Length = 400 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = -1 Query: 420 AKSTPPPPPQEKSGLTI-SEDPYLFSPKAPRCSSRWRELLGFKKLN 286 A S P PQ + I + DPYLFSPKAPRC++RWRELLG KK N Sbjct: 112 AVSASPDTPQVRMRNEICNADPYLFSPKAPRCTTRWRELLGLKKQN 157 >emb|CBI21800.3| unnamed protein product [Vitis vinifera] Length = 282 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -1 Query: 363 DPYLFSPKAPRCSSRWRELLGFKKL-NSQQPK 271 DPYLFSPKAPRCSSRW+ELLG KKL S PK Sbjct: 110 DPYLFSPKAPRCSSRWKELLGLKKLYQSSNPK 141 >ref|XP_002270778.1| PREDICTED: uncharacterized protein LOC100259352 [Vitis vinifera] Length = 418 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -1 Query: 363 DPYLFSPKAPRCSSRWRELLGFKKL-NSQQPK 271 DPYLFSPKAPRCSSRW+ELLG KKL S PK Sbjct: 139 DPYLFSPKAPRCSSRWKELLGLKKLYQSSNPK 170 >emb|CAN69700.1| hypothetical protein VITISV_003292 [Vitis vinifera] Length = 389 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -1 Query: 363 DPYLFSPKAPRCSSRWRELLGFKKL-NSQQPK 271 DPYLFSPKAPRCSSRW+ELLG KKL S PK Sbjct: 138 DPYLFSPKAPRCSSRWKELLGLKKLYQSSNPK 169 >gb|EPS64128.1| hypothetical protein M569_10654, partial [Genlisea aurea] Length = 423 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -1 Query: 369 SEDPYLFSPKAPRCSSRWRELLGFKKL 289 S DPYLFSPKAPRCSSRW+ELLG KKL Sbjct: 158 STDPYLFSPKAPRCSSRWKELLGLKKL 184 >ref|XP_004295696.1| PREDICTED: uncharacterized protein LOC101304556 [Fragaria vesca subsp. vesca] Length = 429 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 363 DPYLFSPKAPRCSSRWRELLGFKKL 289 DPYLFSPKAPRCSSRWRELLG KKL Sbjct: 136 DPYLFSPKAPRCSSRWRELLGLKKL 160 >gb|EMJ12985.1| hypothetical protein PRUPE_ppa006324mg [Prunus persica] Length = 417 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 363 DPYLFSPKAPRCSSRWRELLGFKKL 289 DPYLFSPKAPRCSSRWRELLG KKL Sbjct: 128 DPYLFSPKAPRCSSRWRELLGLKKL 152 >ref|XP_002310690.2| hypothetical protein POPTR_0007s08450g [Populus trichocarpa] gi|550334411|gb|EEE91140.2| hypothetical protein POPTR_0007s08450g [Populus trichocarpa] Length = 453 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 363 DPYLFSPKAPRCSSRWRELLGFKKLNSQQPK 271 DPYLFSPKAPRCSSRW+E LG KKL+ Q PK Sbjct: 144 DPYLFSPKAPRCSSRWKEFLGLKKLH-QNPK 173 >gb|ESW21261.1| hypothetical protein PHAVU_005G055800g [Phaseolus vulgaris] Length = 374 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -1 Query: 414 STPPPPPQEKSGLTISEDPYLFSPKAPRCSSRWRELLGFKKL 289 S P + T + DPY+FSPKAPRCSSRW++LLG KKL Sbjct: 88 SPQTPKTPSYTAATAATDPYVFSPKAPRCSSRWKDLLGLKKL 129