BLASTX nr result
ID: Achyranthes23_contig00053780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00053780 (251 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_002430991.1| conserved hypothetical protein [Escherichia ... 79 8e-13 ref|WP_004923043.1| hypothetical protein [Providencia stuartii] ... 68 1e-09 ref|WP_004247155.1| hypothetical protein [Proteus mirabilis] gi|... 67 2e-09 ref|YP_005855168.1| hypothetical protein LC2W_0248 [Lactobacillu... 66 5e-09 emb|CAR86202.1| Conserved protein [Lactobacillus rhamnosus GG] g... 66 5e-09 ref|WP_001894030.1| hypothetical protein [Vibrio cholerae] gi|12... 66 5e-09 ref|WP_002744838.1| hypothetical protein [Microcystis aeruginosa... 59 7e-07 ref|WP_005325843.1| hypothetical protein [Corynebacterium pseudo... 58 1e-06 gb|ADI17934.1| hypothetical protein [uncultured Desulfobacterale... 58 1e-06 ref|WP_008742847.1| conserved hypothetical protein [Streptomyces... 58 1e-06 emb|CBX28565.1| hypothetical protein N47_G38890 [uncultured Desu... 57 3e-06 gb|EXC35991.1| Ribulose bisphosphate carboxylase large chain [Mo... 55 1e-05 >ref|WP_002430991.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] gi|226903374|gb|EEH89633.1| hypothetical protein ESAG_07158 [Escherichia sp. 3_2_53FAA] Length = 66 Score = 78.6 bits (192), Expect = 8e-13 Identities = 38/54 (70%), Positives = 42/54 (77%) Frame = -3 Query: 168 SP*PIQCSTP*GIHPRRYLNIFRGEPAISQFDWPFTPNHKSSESFSTDTGSDLQ 7 +P P QCSTP RRYLN FRGEPAIS+FDWPFTP+HKSS +FST GS LQ Sbjct: 2 TPLPKQCSTPGDEFTRRYLNSFRGEPAISRFDWPFTPSHKSSANFSTLVGSVLQ 55 >ref|WP_004923043.1| hypothetical protein [Providencia stuartii] gi|188022873|gb|EDU60913.1| hypothetical protein PROSTU_01098 [Providencia stuartii ATCC 25827] Length = 41 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +2 Query: 2 THWRSEPVSVEKDSDDLWLGVKGQSNWEIAGSPRKIFR 115 T+WR+EP +VEK +DDLWLGVKGQSN EIAGSPRK+FR Sbjct: 4 TNWRTEPTNVEKLADDLWLGVKGQSNREIAGSPRKLFR 41 >ref|WP_004247155.1| hypothetical protein [Proteus mirabilis] gi|227161375|gb|EEI46427.1| hypothetical protein HMPREF0693_3633 [Proteus mirabilis ATCC 29906] Length = 41 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +2 Query: 2 THWRSEPVSVEKDSDDLWLGVKGQSNWEIAGSPRKIFR 115 T+WR+EP +VEK +DDLW+GVKGQSN EIAGSPRK+FR Sbjct: 4 TNWRTEPTNVEKLADDLWMGVKGQSNREIAGSPRKLFR 41 >ref|YP_005855168.1| hypothetical protein LC2W_0248 [Lactobacillus casei LC2W] gi|385819441|ref|YP_005855828.1| hypothetical protein LC2W_0910 [Lactobacillus casei LC2W] gi|385819457|ref|YP_005855844.1| hypothetical protein LC2W_0926 [Lactobacillus casei LC2W] gi|385820535|ref|YP_005856922.1| hypothetical protein LC2W_2006 [Lactobacillus casei LC2W] gi|385821204|ref|YP_005857591.1| hypothetical protein LC2W_2677 [Lactobacillus casei LC2W] gi|385821956|ref|YP_005858298.1| hypothetical protein LCBD_0257 [Lactobacillus casei BD-II] gi|385822604|ref|YP_005858946.1| hypothetical protein LCBD_0907 [Lactobacillus casei BD-II] gi|385822619|ref|YP_005858961.1| hypothetical protein LCBD_0922 [Lactobacillus casei BD-II] gi|385823721|ref|YP_005860063.1| hypothetical protein LCBD_2026 [Lactobacillus casei BD-II] gi|385824397|ref|YP_005860739.1| hypothetical protein LCBD_2704 [Lactobacillus casei BD-II] gi|504379271|ref|WP_014566373.1| hypothetical protein [Lactobacillus casei] gi|327381108|gb|AEA52584.1| Conserved protein [Lactobacillus casei LC2W] gi|327381768|gb|AEA53244.1| Conserved protein [Lactobacillus casei LC2W] gi|327381784|gb|AEA53260.1| Conserved protein [Lactobacillus casei LC2W] gi|327382862|gb|AEA54338.1| Conserved protein [Lactobacillus casei LC2W] gi|327383531|gb|AEA55007.1| Conserved protein [Lactobacillus casei LC2W] gi|327384283|gb|AEA55757.1| Conserved protein [Lactobacillus casei BD-II] gi|327384931|gb|AEA56405.1| Conserved protein [Lactobacillus casei BD-II] gi|327384946|gb|AEA56420.1| Conserved protein [Lactobacillus casei BD-II] gi|327386048|gb|AEA57522.1| Conserved protein [Lactobacillus casei BD-II] gi|327386724|gb|AEA58198.1| Conserved protein [Lactobacillus casei BD-II] Length = 131 Score = 65.9 bits (159), Expect = 5e-09 Identities = 38/67 (56%), Positives = 41/67 (61%) Frame = -2 Query: 205 VFGVWLGLVRR*VPLAHPVLYPLRYSSEAIPKYLSRRTSYFPV*LAFHP*PQVIGVFFNR 26 VFGV+L V PL VLY SSEA PK +S RTSY V L FH PQ+I FFN Sbjct: 2 VFGVYLNSVTLDGPLVQTVLYLHDPSSEANPKAISERTSYLQVRLEFHRYPQLIPAFFNI 61 Query: 25 HRFGPPV 5 H FGPPV Sbjct: 62 HGFGPPV 68 >emb|CAR86202.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257147740|emb|CAR86713.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257147759|emb|CAR86732.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257148810|emb|CAR87783.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257149424|emb|CAR88397.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257150160|emb|CAR89132.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257150679|emb|CAR89651.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257150698|emb|CAR89670.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257151737|emb|CAR90709.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257152374|emb|CAR91346.1| Conserved protein [Lactobacillus rhamnosus Lc 705] Length = 131 Score = 65.9 bits (159), Expect = 5e-09 Identities = 38/67 (56%), Positives = 41/67 (61%) Frame = -2 Query: 205 VFGVWLGLVRR*VPLAHPVLYPLRYSSEAIPKYLSRRTSYFPV*LAFHP*PQVIGVFFNR 26 VFGV+L V PL VLY SSEA PK +S RTSY V L FH PQ+I FFN Sbjct: 2 VFGVYLNSVTLDGPLVQTVLYLHDPSSEANPKAISERTSYLQVRLEFHRYPQLIPAFFNI 61 Query: 25 HRFGPPV 5 H FGPPV Sbjct: 62 HGFGPPV 68 >ref|WP_001894030.1| hypothetical protein [Vibrio cholerae] gi|124113458|gb|EAY32278.1| hypothetical protein A55_B0061 [Vibrio cholerae 1587] Length = 41 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 5 HWRSEPVSVEKDSDDLWLGVKGQSNWEIAGSPRKIFR 115 +WR+EP +VEK +DDLWLGVKGQSN EIAGSPRK+FR Sbjct: 5 NWRTEPTNVEKLADDLWLGVKGQSNSEIAGSPRKLFR 41 >ref|WP_002744838.1| hypothetical protein [Microcystis aeruginosa] gi|443332438|gb|ELS47047.1| hypothetical protein C789_3192 [Microcystis aeruginosa DIANCHI905] gi|443332755|gb|ELS47348.1| hypothetical protein C789_2872 [Microcystis aeruginosa DIANCHI905] Length = 102 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = +2 Query: 2 THWRSEPVSVEKDSDDLWLGVKGQSNWEIAGSPRKIFRYRLG*IPQGVEH 151 T WRSEP +VEK +D+LWLGVK QSN E+AGSPR + R GV+H Sbjct: 4 TKWRSEPTNVEKLADELWLGVKCQSNSELAGSPRNVLRRSGSGSLVGVKH 53 >ref|WP_005325843.1| hypothetical protein [Corynebacterium pseudogenitalium] gi|311304693|gb|EFQ80765.1| hypothetical protein HMPREF0305_11076 [Corynebacterium pseudogenitalium ATCC 33035] gi|311304793|gb|EFQ80864.1| hypothetical protein HMPREF0305_11005 [Corynebacterium pseudogenitalium ATCC 33035] Length = 74 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 117 YLNIFRGEPAISQFDWPFTPNHKSSESFSTDTGSDL 10 +LN FRGEPAI++FDWPFTP H SS FST GS L Sbjct: 27 HLNAFRGEPAITEFDWPFTPTHSSSPQFSTYVGSRL 62 >gb|ADI17934.1| hypothetical protein [uncultured Desulfobacterales bacterium HF0200_07G10] Length = 74 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 129 HPRRYLNIFRGEPAISQFDWPFTPNHKSSESFSTDTGSDL 10 + R L +FRGEPAI+ FDWPFTP H SS+ FST TGS L Sbjct: 23 YARLVLKLFRGEPAIAGFDWPFTPIHNSSKLFSTSTGSGL 62 >ref|WP_008742847.1| conserved hypothetical protein [Streptomyces sp. Mg1] gi|194344863|gb|EDX25829.1| conserved hypothetical protein [Streptomyces sp. Mg1] Length = 194 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 117 YLNIFRGEPAISQFDWPFTPNHKSSESFSTDTG 19 +LN FRGEPAI++FDWPFTPNH+SS FST G Sbjct: 2 HLNAFRGEPAITEFDWPFTPNHRSSPRFSTLVG 34 >emb|CBX28565.1| hypothetical protein N47_G38890 [uncultured Desulfobacterium sp.] Length = 75 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -2 Query: 151 VLYPLRYSSEAIPKYLSRRTSYFPV*LAFHP*PQVIGVFFNRHRFGP 11 +LYP +AIPKY+S RTSYF V LAFHP PQ+I V FN RF P Sbjct: 1 MLYPHYLIYKAIPKYISGRTSYFQVCLAFHPYPQLIRVVFNLQRFEP 47 >gb|EXC35991.1| Ribulose bisphosphate carboxylase large chain [Morus notabilis] Length = 552 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +2 Query: 2 THWRSEPVSVEKDSDDLWLGVKGQSNWEIAGSPRKIFRY 118 T WRSEP VE+ +D+LWLGVK SN E+AGSPR R+ Sbjct: 74 TKWRSEPTDVEESADELWLGVKCHSNPELAGSPRNALRH 112