BLASTX nr result
ID: Achyranthes23_contig00053433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00053433 (247 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006402452.1| hypothetical protein EUTSA_v10005894mg [Eutr... 59 9e-07 ref|XP_002523358.1| Beclin-1, putative [Ricinus communis] gi|223... 57 2e-06 ref|XP_006297439.1| hypothetical protein CARUB_v10013463mg [Caps... 56 4e-06 gb|EXB62193.1| Beclin-1-like protein [Morus notabilis] 56 6e-06 ref|XP_006293127.1| hypothetical protein CARUB_v10019433mg [Caps... 55 1e-05 >ref|XP_006402452.1| hypothetical protein EUTSA_v10005894mg [Eutrema salsugineum] gi|557103551|gb|ESQ43905.1| hypothetical protein EUTSA_v10005894mg [Eutrema salsugineum] Length = 515 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 146 DKRRNFEVDPNLPKWVCQKCRHSLSIVGVVDSFA 247 DK R F VDPNLPKWVCQKC HSL+IVG VDS+A Sbjct: 8 DKSRAFPVDPNLPKWVCQKCHHSLTIVG-VDSYA 40 >ref|XP_002523358.1| Beclin-1, putative [Ricinus communis] gi|223537446|gb|EEF39074.1| Beclin-1, putative [Ricinus communis] Length = 523 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 146 DKRRNFEVDPNLPKWVCQKCRHSLSIVGVVDSFA 247 DK R F VDPNLP+WVCQ CRHSL IVG VDS+A Sbjct: 9 DKSRTFPVDPNLPRWVCQNCRHSLCIVG-VDSYA 41 >ref|XP_006297439.1| hypothetical protein CARUB_v10013463mg [Capsella rubella] gi|565479600|ref|XP_006297440.1| hypothetical protein CARUB_v10013463mg [Capsella rubella] gi|482566148|gb|EOA30337.1| hypothetical protein CARUB_v10013463mg [Capsella rubella] gi|482566149|gb|EOA30338.1| hypothetical protein CARUB_v10013463mg [Capsella rubella] Length = 518 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 146 DKRRNFEVDPNLPKWVCQKCRHSLSIVGVVDSFA 247 DK R +VDPNLPKWVCQ C HSL+IVG VDS+A Sbjct: 8 DKTRTIQVDPNLPKWVCQNCHHSLTIVG-VDSYA 40 >gb|EXB62193.1| Beclin-1-like protein [Morus notabilis] Length = 513 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 140 NNDKRRNFEVDPNLPKWVCQKCRHSLSIVGVVDSFA 247 N RNF VDPNLP+WVCQ CRHSL +VG VDS+A Sbjct: 2 NEKGGRNFPVDPNLPRWVCQNCRHSLCVVG-VDSYA 36 >ref|XP_006293127.1| hypothetical protein CARUB_v10019433mg [Capsella rubella] gi|482561834|gb|EOA26025.1| hypothetical protein CARUB_v10019433mg [Capsella rubella] Length = 519 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +2 Query: 146 DKRRNFEVDPNLPKWVCQKCRHSLSIVGVVDSFA 247 DK R VDPNLPKWVCQ C HSL+IVG VDS+A Sbjct: 8 DKTRTIPVDPNLPKWVCQNCHHSLTIVG-VDSYA 40