BLASTX nr result
ID: Achyranthes23_contig00052885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00052885 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327789.1| predicted protein [Populus trichocarpa] gi|5... 58 1e-06 ref|XP_003538863.1| PREDICTED: uncharacterized protein LOC100796... 57 3e-06 ref|XP_006574292.1| PREDICTED: salicylate carboxymethyltransfera... 57 3e-06 ref|XP_002521539.1| metal ion binding protein, putative [Ricinus... 57 3e-06 ref|XP_006466837.1| PREDICTED: copper transport protein CCH-like... 56 4e-06 ref|XP_006425629.1| hypothetical protein CICLE_v10027136mg [Citr... 56 4e-06 ref|XP_006340656.1| PREDICTED: copper transport protein CCH-like... 56 6e-06 ref|XP_003612070.1| hypothetical protein MTR_5g020960 [Medicago ... 56 6e-06 ref|XP_004512072.1| PREDICTED: uncharacterized protein LOC101510... 55 7e-06 gb|ESW28977.1| hypothetical protein PHAVU_002G033800g [Phaseolus... 55 1e-05 ref|XP_002310259.1| heavy-metal-associated domain-containing fam... 55 1e-05 >ref|XP_002327789.1| predicted protein [Populus trichocarpa] gi|566170959|ref|XP_006383167.1| heavy-metal-associated domain-containing family protein [Populus trichocarpa] gi|550338748|gb|ERP60964.1| heavy-metal-associated domain-containing family protein [Populus trichocarpa] Length = 133 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 M +TV KVD+S +KCKK++ VS LEGV+KIEAD+ KGT+TV Sbjct: 1 MAQRTVLKVDISCEKCKKKLLKAVSTLEGVDKIEADQAKGTLTV 44 >ref|XP_003538863.1| PREDICTED: uncharacterized protein LOC100796373 [Glycine max] Length = 132 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 MV KTV KVD+S KCK+++ IVS ++GV+KIEAD+ KGT+TV Sbjct: 1 MVKKTVLKVDISCLKCKRKLLKIVSSIQGVDKIEADEGKGTLTV 44 >ref|XP_006574292.1| PREDICTED: salicylate carboxymethyltransferase-like [Glycine max] Length = 405 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 MV KTV KVD+S KCK ++ IVS L+GV+KIEAD+ KGT+TV Sbjct: 295 MVKKTVLKVDISCLKCKTKLLKIVSSLQGVDKIEADEGKGTLTV 338 >ref|XP_002521539.1| metal ion binding protein, putative [Ricinus communis] gi|223539217|gb|EEF40810.1| metal ion binding protein, putative [Ricinus communis] Length = 883 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -1 Query: 157 EANCSLKMVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 E MV +TV KVD+S +CKK+V VS +EGV+KIE D+ KGT+TV Sbjct: 42 ETETETSMVQRTVLKVDLSCQRCKKKVLKSVSAIEGVDKIETDEAKGTLTV 92 >ref|XP_006466837.1| PREDICTED: copper transport protein CCH-like isoform X1 [Citrus sinensis] gi|568824918|ref|XP_006466838.1| PREDICTED: copper transport protein CCH-like isoform X2 [Citrus sinensis] Length = 147 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 MV +TV KVD+S KCKKQ+ VS ++GV+KIE D KGT+TV Sbjct: 1 MVQRTVLKVDISCQKCKKQLLRAVSSIQGVDKIEIDAAKGTLTV 44 >ref|XP_006425629.1| hypothetical protein CICLE_v10027136mg [Citrus clementina] gi|557527619|gb|ESR38869.1| hypothetical protein CICLE_v10027136mg [Citrus clementina] Length = 129 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 MV +TV KVD+S KCKKQ+ VS ++GV+KIE D KGT+TV Sbjct: 1 MVQRTVLKVDISCQKCKKQLLRAVSSIQGVDKIEIDAAKGTLTV 44 >ref|XP_006340656.1| PREDICTED: copper transport protein CCH-like [Solanum tuberosum] Length = 138 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 MV KTV KVDVS DKCKK++ VS L GV KIE D KGT++V Sbjct: 1 MVQKTVLKVDVSCDKCKKKILKAVSGLPGVEKIEIDGAKGTLSV 44 >ref|XP_003612070.1| hypothetical protein MTR_5g020960 [Medicago truncatula] gi|355513405|gb|AES95028.1| hypothetical protein MTR_5g020960 [Medicago truncatula] Length = 157 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTVI 2 MV KTV KV++ KCKK++ VS LEG++KIEAD+ KGT+T++ Sbjct: 1 MVKKTVLKVNIDCPKCKKKLIKTVSSLEGIDKIEADEVKGTLTIL 45 >ref|XP_004512072.1| PREDICTED: uncharacterized protein LOC101510869 [Cicer arietinum] Length = 144 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 MV KTV KVD+ KCKK++ VS L+G++KIEAD+ KGT+TV Sbjct: 1 MVQKTVLKVDIDCLKCKKKLIKTVSSLQGIDKIEADEGKGTLTV 44 >gb|ESW28977.1| hypothetical protein PHAVU_002G033800g [Phaseolus vulgaris] gi|561030399|gb|ESW28978.1| hypothetical protein PHAVU_002G033800g [Phaseolus vulgaris] Length = 137 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 MV KTV KVD++ KCK+++ VS L+GV+KIEAD+ KGT+TV Sbjct: 1 MVKKTVLKVDITCVKCKRKLLKTVSSLQGVDKIEADEGKGTLTV 44 >ref|XP_002310259.1| heavy-metal-associated domain-containing family protein [Populus trichocarpa] gi|222853162|gb|EEE90709.1| heavy-metal-associated domain-containing family protein [Populus trichocarpa] Length = 132 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -1 Query: 136 MVHKTVFKVDVSTDKCKKQVFGIVSKLEGVNKIEADKEKGTVTV 5 MV +TV KVD+S KCK +V VS LEGV+ IEAD+ KGT+TV Sbjct: 1 MVQRTVLKVDISCQKCKTKVLKAVSTLEGVDTIEADQGKGTLTV 44