BLASTX nr result
ID: Achyranthes23_contig00052865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00052865 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006405562.1| hypothetical protein EUTSA_v10028314mg [Eutr... 55 1e-05 >ref|XP_006405562.1| hypothetical protein EUTSA_v10028314mg [Eutrema salsugineum] gi|557106700|gb|ESQ47015.1| hypothetical protein EUTSA_v10028314mg [Eutrema salsugineum] Length = 86 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = +1 Query: 139 GTERHSISAKHNPFYVSKRRVPSGPDPIHNRHVGDTRRQPGRL 267 G H I NPF+VSKR+VP+GPDPIHNR +RR P +L Sbjct: 38 GKNTHQIHKNVNPFHVSKRKVPNGPDPIHNRRAETSRRSPMKL 80