BLASTX nr result
ID: Achyranthes23_contig00052780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00052780 (272 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535828.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002535828.1| conserved hypothetical protein [Ricinus communis] gi|255608154|ref|XP_002538850.1| conserved hypothetical protein [Ricinus communis] gi|223510119|gb|EEF23533.1| conserved hypothetical protein [Ricinus communis] gi|223521805|gb|EEF26555.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = -3 Query: 249 GSTRLVKFRRKTVGGRWRHFCDPLKNKGNAGRVELRGGFENRVRSC 112 GSTR VKFRRKTVG RWR F PL+ + V+L GFENRV SC Sbjct: 40 GSTRSVKFRRKTVGSRWRPFFGPLQKEMRGRGVKLGRGFENRVGSC 85