BLASTX nr result
ID: Achyranthes23_contig00052553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00052553 (240 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346322.1| PREDICTED: QWRF motif-containing protein 2-l... 56 4e-06 >ref|XP_006346322.1| PREDICTED: QWRF motif-containing protein 2-like [Solanum tuberosum] Length = 641 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 4 VAPPKLSQSRKY-SDGPMSSPRTMSSPIRGAVRSASPNKLINT 129 VAPPKL RKY SD P+SSPR MSSPIRG +RSASP+KLI + Sbjct: 357 VAPPKL---RKYHSDFPVSSPRAMSSPIRGGIRSASPSKLIGS 396