BLASTX nr result
ID: Achyranthes23_contig00052529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00052529 (224 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004495669.1| PREDICTED: uncharacterized protein LOC101513... 55 8e-06 gb|EMJ08988.1| hypothetical protein PRUPE_ppa025734mg [Prunus pe... 55 1e-05 >ref|XP_004495669.1| PREDICTED: uncharacterized protein LOC101513260 [Cicer arietinum] Length = 162 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +1 Query: 118 LNIPPPAINQFCYGPCLAETHLVLDCVDHSLSNFI 222 + +PP A + FC GPCL ETHL+LDC+D+ LSNFI Sbjct: 66 IKVPPEATDFFCSGPCLTETHLLLDCIDNILSNFI 100 >gb|EMJ08988.1| hypothetical protein PRUPE_ppa025734mg [Prunus persica] Length = 167 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 121 NIPPPAINQFCYGPCLAETHLVLDCVDHSLSNFI 222 N+PP A + FC+GPCLAET VL+CVDH LS F+ Sbjct: 66 NVPPEATDLFCHGPCLAETQQVLNCVDHMLSGFV 99