BLASTX nr result
ID: Achyranthes23_contig00052270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00052270 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531218.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002531218.1| conserved hypothetical protein [Ricinus communis] gi|223529178|gb|EEF31154.1| conserved hypothetical protein [Ricinus communis] Length = 438 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = +2 Query: 50 VVAGKRQLDSGDSSLSMSPPRYKRRKVSAIRDFPDGCGPNAVGIIPQK 193 V++G+ +++G + SPP+YKRR+VSAIRDFP GCGP+ + I P K Sbjct: 15 VISGRLPMENGHTDSHGSPPKYKRRRVSAIRDFPVGCGPSRI-IAPMK 61