BLASTX nr result
ID: Achyranthes23_contig00052182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00052182 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40486.1| putative polyprotein [Solanum demissum] 56 4e-06 >gb|AAT40486.1| putative polyprotein [Solanum demissum] Length = 1065 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/50 (58%), Positives = 33/50 (66%) Frame = -2 Query: 210 GEQCNLVYLFHPVHSIQANKSTIHDNAILWHRRLGHPSMKVIRSLPGISS 61 GEQC+ VY F QAN + DN LWHRRLGHPS K++ LPGISS Sbjct: 433 GEQCDGVYYFKA--QAQANNTHKVDNFDLWHRRLGHPSNKIVSLLPGISS 480