BLASTX nr result
ID: Achyranthes23_contig00051870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00051870 (246 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004290509.1| PREDICTED: sterol 3-beta-glucosyltransferase... 55 7e-06 ref|XP_003564697.1| PREDICTED: sterol 3-beta-glucosyltransferase... 55 1e-05 >ref|XP_004290509.1| PREDICTED: sterol 3-beta-glucosyltransferase-like [Fragaria vesca subsp. vesca] Length = 620 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = +2 Query: 89 NLAKSDAVASKQSKLHSSGSASVLVEGATTNLSKSIPRLKIAMLVVGTRGDV 244 +L +S VAS+ +LHS + ++ T++++KSIPRLKIAMLVVGTRGDV Sbjct: 128 DLERSAPVASELLELHSVEDVPISLDDTTSSITKSIPRLKIAMLVVGTRGDV 179 >ref|XP_003564697.1| PREDICTED: sterol 3-beta-glucosyltransferase-like [Brachypodium distachyon] Length = 617 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +2 Query: 89 NLAKSDAVASKQSKLHSSGSASVLVEGATTNLSKSIPRLKIAMLVVGTRGDV 244 ++ +S VAS+ S + + GS VE T+ LSKS+P+LKIAMLVVGTRGDV Sbjct: 126 DVTRSALVASELSAIDAFGSVPRDVEAVTSGLSKSVPKLKIAMLVVGTRGDV 177