BLASTX nr result
ID: Achyranthes23_contig00051692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00051692 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491240.1| PREDICTED: uncharacterized protein At5g05190... 84 2e-14 ref|XP_006444880.1| hypothetical protein CICLE_v10018757mg [Citr... 84 2e-14 gb|EOX95766.1| Uncharacterized protein isoform 5 [Theobroma cacao] 82 1e-13 gb|EOX95765.1| Uncharacterized protein isoform 4, partial [Theob... 82 1e-13 gb|EOX95764.1| Uncharacterized protein isoform 3, partial [Theob... 82 1e-13 gb|EOX95763.1| Uncharacterized protein isoform 2 [Theobroma cacao] 82 1e-13 gb|EOX95762.1| Uncharacterized protein isoform 1 [Theobroma cacao] 82 1e-13 gb|EXB62219.1| hypothetical protein L484_017607 [Morus notabilis] 79 5e-13 ref|XP_004308319.1| PREDICTED: uncharacterized protein LOC101299... 78 1e-12 gb|EMJ21467.1| hypothetical protein PRUPE_ppa001028mg [Prunus pe... 77 2e-12 gb|EXC02937.1| hypothetical protein L484_012064 [Morus notabilis] 76 5e-12 ref|XP_006339682.1| PREDICTED: uncharacterized protein LOC102601... 75 7e-12 ref|XP_002533909.1| hypothetical protein RCOM_0237030 [Ricinus c... 73 3e-11 ref|XP_004168407.1| PREDICTED: uncharacterized LOC101208193 [Cuc... 72 8e-11 ref|XP_004134311.1| PREDICTED: uncharacterized protein LOC101208... 72 8e-11 gb|ADN34175.1| hypothetical protein [Cucumis melo subsp. melo] 72 8e-11 emb|CBI34458.3| unnamed protein product [Vitis vinifera] 72 8e-11 ref|XP_002271107.1| PREDICTED: uncharacterized protein LOC100243... 72 8e-11 ref|XP_002320185.2| hypothetical protein POPTR_0014s09140g [Popu... 72 1e-10 ref|XP_006339681.1| PREDICTED: uncharacterized protein LOC102601... 70 2e-10 >ref|XP_006491240.1| PREDICTED: uncharacterized protein At5g05190-like [Citrus sinensis] Length = 915 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVGIVS 156 RCPKCENLLPEL DYSVYQCGGCGAVLRAK EA S+++ EERVG VS Sbjct: 11 RCPKCENLLPELEDYSVYQCGGCGAVLRAKNKKREADTSSEKSEEERVGEVS 62 >ref|XP_006444880.1| hypothetical protein CICLE_v10018757mg [Citrus clementina] gi|557547142|gb|ESR58120.1| hypothetical protein CICLE_v10018757mg [Citrus clementina] Length = 915 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVGIVS 156 RCPKCENLLPEL DYSVYQCGGCGAVLRAK EA S+++ EERVG VS Sbjct: 11 RCPKCENLLPELEDYSVYQCGGCGAVLRAKNKKREADTSSEKSEEERVGEVS 62 >gb|EOX95766.1| Uncharacterized protein isoform 5 [Theobroma cacao] Length = 839 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVGIVS 156 RCPKCENLLPEL DYSVYQCGGCGAVLRAK N EA S+++ E+R+G VS Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGAVLRAKVRNREADTFSEKSEEDRLGGVS 62 >gb|EOX95765.1| Uncharacterized protein isoform 4, partial [Theobroma cacao] Length = 839 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVGIVS 156 RCPKCENLLPEL DYSVYQCGGCGAVLRAK N EA S+++ E+R+G VS Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGAVLRAKVRNREADTFSEKSEEDRLGGVS 62 >gb|EOX95764.1| Uncharacterized protein isoform 3, partial [Theobroma cacao] Length = 855 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVGIVS 156 RCPKCENLLPEL DYSVYQCGGCGAVLRAK N EA S+++ E+R+G VS Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGAVLRAKVRNREADTFSEKSEEDRLGGVS 62 >gb|EOX95763.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 844 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVGIVS 156 RCPKCENLLPEL DYSVYQCGGCGAVLRAK N EA S+++ E+R+G VS Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGAVLRAKVRNREADTFSEKSEEDRLGGVS 62 >gb|EOX95762.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 921 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVGIVS 156 RCPKCENLLPEL DYSVYQCGGCGAVLRAK N EA S+++ E+R+G VS Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGAVLRAKVRNREADTFSEKSEEDRLGGVS 62 >gb|EXB62219.1| hypothetical protein L484_017607 [Morus notabilis] Length = 298 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVGIVS 156 RCPKCENLLPEL DYSVYQCGGCGAVLRAK E S+++ EE+VG VS Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGAVLRAKAKGQEGDTLSEKSDEEKVGGVS 62 >ref|XP_004308319.1| PREDICTED: uncharacterized protein LOC101299137 [Fragaria vesca subsp. vesca] Length = 921 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVG 147 RCPKCENLLPEL DYSVYQCGGCGAVLRAKK + S+++ EE VG Sbjct: 12 RCPKCENLLPELADYSVYQCGGCGAVLRAKKKRQDGDTLSEKSDEETVG 60 >gb|EMJ21467.1| hypothetical protein PRUPE_ppa001028mg [Prunus persica] Length = 929 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/52 (71%), Positives = 39/52 (75%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVGIVS 156 RCPKCENLLPEL DYSVYQCGGCGAVL A K E S ++ EERVG VS Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGAVLGANKKRQEGDTLSMKSDEERVGGVS 62 >gb|EXC02937.1| hypothetical protein L484_012064 [Morus notabilis] Length = 931 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVG 147 RCPKC+NLLPELPDYSVYQCGGCGA+LRAKK ++ S+++ EE+ G Sbjct: 11 RCPKCDNLLPELPDYSVYQCGGCGAILRAKKRYADNDMLSEKSDEEKGG 59 >ref|XP_006339682.1| PREDICTED: uncharacterized protein LOC102601197 isoform X2 [Solanum tuberosum] Length = 1002 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERV 144 RCPKCENLLPEL DYSVYQCGGCGAVLRAK N E +++ EE V Sbjct: 11 RCPKCENLLPELTDYSVYQCGGCGAVLRAKNKNGELNKFVEKSDEETV 58 >ref|XP_002533909.1| hypothetical protein RCOM_0237030 [Ricinus communis] gi|223526130|gb|EEF28474.1| hypothetical protein RCOM_0237030 [Ricinus communis] Length = 916 Score = 73.2 bits (178), Expect = 3e-11 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASE-ERVGIVSD 159 RCPKCENLLPEL DYSVYQCGGCGAVLRAK N + S ++ E + VG+ ++ Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGAVLRAKDKNPDTDTVSHKSDEAQLVGVATE 64 >ref|XP_004168407.1| PREDICTED: uncharacterized LOC101208193 [Cucumis sativus] Length = 878 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERV 144 RCPKCENLLPEL DYSVYQCGGCG VLRAK N E S ++ E+ V Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGTVLRAKVRNKEEDSLSYKSDEDGV 58 >ref|XP_004134311.1| PREDICTED: uncharacterized protein LOC101208193 [Cucumis sativus] Length = 907 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERV 144 RCPKCENLLPEL DYSVYQCGGCG VLRAK N E S ++ E+ V Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGTVLRAKVRNKEEDSLSYKSDEDGV 58 >gb|ADN34175.1| hypothetical protein [Cucumis melo subsp. melo] Length = 909 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERV 144 RCPKCENLLPEL DYSVYQCGGCG VLRAK N E S ++ E+ V Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGTVLRAKVRNKEEDSLSYKSDEDGV 58 >emb|CBI34458.3| unnamed protein product [Vitis vinifera] Length = 712 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVG 147 RCPKCENLLPELPDY VYQCGGCGAVLRAKK + + D S++ G Sbjct: 11 RCPKCENLLPELPDYPVYQCGGCGAVLRAKK-KAPSNDALSEKSDDENG 58 >ref|XP_002271107.1| PREDICTED: uncharacterized protein LOC100243335 [Vitis vinifera] Length = 956 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEERVG 147 RCPKCENLLPELPDY VYQCGGCGAVLRAKK + + D S++ G Sbjct: 11 RCPKCENLLPELPDYPVYQCGGCGAVLRAKK-KAPSNDALSEKSDDENG 58 >ref|XP_002320185.2| hypothetical protein POPTR_0014s09140g [Populus trichocarpa] gi|550323811|gb|EEE98500.2| hypothetical protein POPTR_0014s09140g [Populus trichocarpa] Length = 900 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLRAKKGNSEARDGSQRASEE 138 RCPKCENLLPEL DYSVYQCGGCGAVLRAK N + S S+E Sbjct: 11 RCPKCENLLPELADYSVYQCGGCGAVLRAKNKNRDTDTLSLEKSDE 56 >ref|XP_006339681.1| PREDICTED: uncharacterized protein LOC102601197 isoform X1 [Solanum tuberosum] Length = 1004 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +1 Query: 1 RCPKCENLLPELPDYSVYQCGGCGAVLR--AKKGNSEARDGSQRASEERV 144 RCPKCENLLPEL DYSVYQCGGCGAVLR AK N E +++ EE V Sbjct: 11 RCPKCENLLPELTDYSVYQCGGCGAVLRVTAKNKNGELNKFVEKSDEETV 60