BLASTX nr result
ID: Achyranthes23_contig00051582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00051582 (305 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEV42258.1| hypothetical protein [Beta vulgaris] 41 1e-07 >gb|AEV42258.1| hypothetical protein [Beta vulgaris] Length = 1553 Score = 41.2 bits (95), Expect(2) = 1e-07 Identities = 18/40 (45%), Positives = 28/40 (70%) Frame = +1 Query: 133 GTITVDEYYLKFLEYDKYSLDNVMIEEKKMQRFELGLTVE 252 G ++V+EYY KF+E +++ + EE K RFELGLT++ Sbjct: 141 GNMSVEEYYRKFIELMRFAPEIAPTEEAKASRFELGLTLD 180 Score = 40.0 bits (92), Expect(2) = 1e-07 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 35 GFG*EQFKTTIRDIYYPPHMRKENSNEFPRFGMG 136 GFG E FK +RD YYPP+++K+ + EF G Sbjct: 108 GFGWETFKKALRDKYYPPYLKKQKAQEFMMLEQG 141