BLASTX nr result
ID: Achyranthes23_contig00051348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00051348 (438 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268449.2| PREDICTED: protein YIF1B [Vitis vinifera] 80 2e-13 emb|CBI36691.3| unnamed protein product [Vitis vinifera] 80 2e-13 gb|EOY04845.1| Integral membrane HRF1 family protein [Theobroma ... 78 1e-12 gb|EMJ17006.1| hypothetical protein PRUPE_ppa009973mg [Prunus pe... 78 1e-12 ref|XP_004152088.1| PREDICTED: protein YIF1B-A-like [Cucumis sat... 78 1e-12 ref|XP_004507253.1| PREDICTED: protein YIF1B-like [Cicer arietinum] 77 2e-12 ref|XP_004309807.1| PREDICTED: protein YIF1B-B-like [Fragaria ve... 77 2e-12 gb|ESW23450.1| hypothetical protein PHAVU_004G048100g [Phaseolus... 77 3e-12 ref|XP_003555074.1| PREDICTED: protein YIF1B-like [Glycine max] 77 3e-12 ref|XP_003552633.1| PREDICTED: protein YIF1B-like isoform X1 [Gl... 77 3e-12 ref|NP_001242205.1| uncharacterized protein LOC100799056 [Glycin... 77 3e-12 ref|XP_006415396.1| hypothetical protein EUTSA_v10008472mg [Eutr... 76 5e-12 gb|AAF98195.1|AC000107_18 F17F8.24 [Arabidopsis thaliana] 76 5e-12 gb|AFK45302.1| unknown [Medicago truncatula] 76 5e-12 ref|XP_003621615.1| Protein YIF1B-B [Medicago truncatula] gi|355... 76 5e-12 ref|NP_564367.1| integral membrane HRF1-like protein [Arabidopsi... 76 5e-12 ref|XP_002534138.1| Protein YIF1A, putative [Ricinus communis] g... 75 7e-12 gb|ESW11341.1| hypothetical protein PHAVU_008G021900g [Phaseolus... 75 9e-12 ref|XP_006402683.1| hypothetical protein EUTSA_v10006169mg [Eutr... 75 9e-12 gb|AFK38884.1| unknown [Lotus japonicus] 75 1e-11 >ref|XP_002268449.2| PREDICTED: protein YIF1B [Vitis vinifera] Length = 348 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWL 319 VLFAEVRSYDSSRHH LLLFIALAQ PLFIWLGN+SVHWL Sbjct: 308 VLFAEVRSYDSSRHHYLLLFIALAQLPLFIWLGNISVHWL 347 >emb|CBI36691.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWL 319 VLFAEVRSYDSSRHH LLLFIALAQ PLFIWLGN+SVHWL Sbjct: 297 VLFAEVRSYDSSRHHYLLLFIALAQLPLFIWLGNISVHWL 336 >gb|EOY04845.1| Integral membrane HRF1 family protein [Theobroma cacao] Length = 269 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWL 319 VLFAEVRSYDSSRHH LLLFIALAQFPLF WLGN+SV+WL Sbjct: 229 VLFAEVRSYDSSRHHYLLLFIALAQFPLFTWLGNISVNWL 268 >gb|EMJ17006.1| hypothetical protein PRUPE_ppa009973mg [Prunus persica] Length = 269 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLLFIALAQFPLF WLGNVSV+WL+ Sbjct: 229 VLFAEVRSYDSSKHHYLLLFIALAQFPLFTWLGNVSVNWLI 269 >ref|XP_004152088.1| PREDICTED: protein YIF1B-A-like [Cucumis sativus] gi|449502274|ref|XP_004161595.1| PREDICTED: protein YIF1B-A-like [Cucumis sativus] Length = 269 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVR+YDSSRHH LLLFIALAQFPLF WLGNVSV+WL+ Sbjct: 229 VLFAEVRTYDSSRHHYLLLFIALAQFPLFTWLGNVSVNWLI 269 >ref|XP_004507253.1| PREDICTED: protein YIF1B-like [Cicer arietinum] Length = 270 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLLFIAL QFPLFIWLGN++++WLL Sbjct: 230 VLFAEVRSYDSSKHHYLLLFIALVQFPLFIWLGNITINWLL 270 >ref|XP_004309807.1| PREDICTED: protein YIF1B-B-like [Fragaria vesca subsp. vesca] Length = 263 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLLFIALAQFP+F WLGNVSV+WL+ Sbjct: 223 VLFAEVRSYDSSKHHYLLLFIALAQFPVFTWLGNVSVNWLI 263 >gb|ESW23450.1| hypothetical protein PHAVU_004G048100g [Phaseolus vulgaris] Length = 269 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSSRHH LLLFIAL QFPLF WLGN++++WLL Sbjct: 229 VLFAEVRSYDSSRHHYLLLFIALVQFPLFTWLGNITINWLL 269 >ref|XP_003555074.1| PREDICTED: protein YIF1B-like [Glycine max] Length = 269 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSSRHH LLLFIAL QFPLF WLGN++++WLL Sbjct: 229 VLFAEVRSYDSSRHHYLLLFIALVQFPLFTWLGNITINWLL 269 >ref|XP_003552633.1| PREDICTED: protein YIF1B-like isoform X1 [Glycine max] gi|571549724|ref|XP_006602991.1| PREDICTED: protein YIF1B-like isoform X2 [Glycine max] gi|571549730|ref|XP_006602992.1| PREDICTED: protein YIF1B-like isoform X3 [Glycine max] gi|571549733|ref|XP_006602993.1| PREDICTED: protein YIF1B-like isoform X4 [Glycine max] gi|571549737|ref|XP_006602994.1| PREDICTED: protein YIF1B-like isoform X5 [Glycine max] Length = 273 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLLFIALAQFPLF WLGN++V+WL+ Sbjct: 233 VLFAEVRSYDSSKHHYLLLFIALAQFPLFTWLGNITVNWLI 273 >ref|NP_001242205.1| uncharacterized protein LOC100799056 [Glycine max] gi|255641178|gb|ACU20866.1| unknown [Glycine max] Length = 269 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSSRHH LLLFIAL QFPLF WLGN++++WLL Sbjct: 229 VLFAEVRSYDSSRHHYLLLFIALVQFPLFTWLGNITINWLL 269 >ref|XP_006415396.1| hypothetical protein EUTSA_v10008472mg [Eutrema salsugineum] gi|557093167|gb|ESQ33749.1| hypothetical protein EUTSA_v10008472mg [Eutrema salsugineum] Length = 269 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLLF+AL QFPL IWLGN+SV+WLL Sbjct: 229 VLFAEVRSYDSSKHHYLLLFLALVQFPLLIWLGNISVNWLL 269 >gb|AAF98195.1|AC000107_18 F17F8.24 [Arabidopsis thaliana] Length = 286 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLLF+AL QFPL IWLGN+SV+WLL Sbjct: 246 VLFAEVRSYDSSKHHYLLLFLALVQFPLLIWLGNISVNWLL 286 >gb|AFK45302.1| unknown [Medicago truncatula] Length = 273 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLLFIALAQFPLF+WLGN++V+W + Sbjct: 233 VLFAEVRSYDSSKHHYLLLFIALAQFPLFMWLGNITVNWFI 273 >ref|XP_003621615.1| Protein YIF1B-B [Medicago truncatula] gi|355496630|gb|AES77833.1| Protein YIF1B-B [Medicago truncatula] Length = 382 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLLFIALAQFPLF+WLGN++V+W + Sbjct: 342 VLFAEVRSYDSSKHHYLLLFIALAQFPLFMWLGNITVNWFI 382 >ref|NP_564367.1| integral membrane HRF1-like protein [Arabidopsis thaliana] gi|145324088|ref|NP_001077633.1| integral membrane HRF1-like protein [Arabidopsis thaliana] gi|14532658|gb|AAK64057.1| unknown protein [Arabidopsis thaliana] gi|21280943|gb|AAM44952.1| unknown protein [Arabidopsis thaliana] gi|21554340|gb|AAM63447.1| unknown [Arabidopsis thaliana] gi|332193168|gb|AEE31289.1| integral membrane HRF1-like protein [Arabidopsis thaliana] gi|332193169|gb|AEE31290.1| integral membrane HRF1-like protein [Arabidopsis thaliana] Length = 269 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLLF+AL QFPL IWLGN+SV+WLL Sbjct: 229 VLFAEVRSYDSSKHHYLLLFLALVQFPLLIWLGNISVNWLL 269 >ref|XP_002534138.1| Protein YIF1A, putative [Ricinus communis] gi|223525796|gb|EEF28242.1| Protein YIF1A, putative [Ricinus communis] Length = 269 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWL 319 VLFAEVR+YDSSRHH LLLFIALAQFPLF WLGN++++WL Sbjct: 229 VLFAEVRTYDSSRHHYLLLFIALAQFPLFTWLGNITINWL 268 >gb|ESW11341.1| hypothetical protein PHAVU_008G021900g [Phaseolus vulgaris] gi|561012481|gb|ESW11342.1| hypothetical protein PHAVU_008G021900g [Phaseolus vulgaris] Length = 273 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVRSYDSS+HH LLL IALAQFPLFIWLGN++V+W++ Sbjct: 233 VLFAEVRSYDSSKHHYLLLLIALAQFPLFIWLGNITVNWVI 273 >ref|XP_006402683.1| hypothetical protein EUTSA_v10006169mg [Eutrema salsugineum] gi|557103782|gb|ESQ44136.1| hypothetical protein EUTSA_v10006169mg [Eutrema salsugineum] Length = 269 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWL 319 VLFAE RSYDSSRHH LL+F+ALAQFPL IWLGN+SV+WL Sbjct: 229 VLFAEARSYDSSRHHYLLIFVALAQFPLLIWLGNISVNWL 268 >gb|AFK38884.1| unknown [Lotus japonicus] Length = 269 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 438 VLFAEVRSYDSSRHHSLLLFIALAQFPLFIWLGNVSVHWLL 316 VLFAEVR+YDSS+HH LLLFIAL QFPLF WLGN++V+WLL Sbjct: 229 VLFAEVRTYDSSKHHYLLLFIALVQFPLFTWLGNITVNWLL 269