BLASTX nr result
ID: Achyranthes23_contig00050022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00050022 (308 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX98227.1| AP2/B3-like transcriptional factor family protein... 59 5e-07 >gb|EOX98227.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma cacao] Length = 258 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 181 MVTAASNYEEKRKQRLEENKKRMEELNLHNLSKALKPT-PKPS 306 MV + YE+ RK+RLEENKKRMEELNL NLS+ALK T PKPS Sbjct: 1 MVAPKATYEQMRKRRLEENKKRMEELNLKNLSQALKNTSPKPS 43