BLASTX nr result
ID: Achyranthes23_contig00050014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00050014 (274 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFO70202.1| putative ammonium transporter AMT1;3, partial [Al... 79 6e-13 gb|AFU34590.1| ammonium transporter 1;3 [Alternanthera philoxero... 79 6e-13 ref|XP_006848199.1| hypothetical protein AMTR_s00029p00240590 [A... 55 1e-05 >gb|AFO70202.1| putative ammonium transporter AMT1;3, partial [Alternanthera philoxeroides] Length = 412 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 274 EEVAGLDISSHGGYAYHNQEDDERPVRYKDYIRMQN 167 EEVAGLDISSHGGYAYHNQEDDERP+RYKDYIRMQN Sbjct: 377 EEVAGLDISSHGGYAYHNQEDDERPLRYKDYIRMQN 412 >gb|AFU34590.1| ammonium transporter 1;3 [Alternanthera philoxeroides] Length = 462 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 274 EEVAGLDISSHGGYAYHNQEDDERPVRYKDYIRMQN 167 EEVAGLDISSHGGYAYHNQEDDERP+RYKDYIRMQN Sbjct: 427 EEVAGLDISSHGGYAYHNQEDDERPLRYKDYIRMQN 462 >ref|XP_006848199.1| hypothetical protein AMTR_s00029p00240590 [Amborella trichopoda] gi|548851504|gb|ERN09780.1| hypothetical protein AMTR_s00029p00240590 [Amborella trichopoda] Length = 456 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -1 Query: 274 EEVAGLDISSHGGYAYHNQEDDERPVRYKDYIRMQ 170 EEVAGLD+S HGGYAY DDE P Y DY+RMQ Sbjct: 417 EEVAGLDVSHHGGYAYQAHHDDEEPRFYADYVRMQ 451