BLASTX nr result
ID: Achyranthes23_contig00048183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00048183 (377 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006467202.1| PREDICTED: serine/threonine-protein kinase O... 58 1e-06 ref|XP_006446047.1| hypothetical protein CICLE_v10015414mg [Citr... 58 1e-06 gb|EXB48381.1| Serine/threonine-protein kinase OXI1 [Morus notab... 58 1e-06 ref|XP_002297784.2| hypothetical protein POPTR_0001s05570g [Popu... 57 2e-06 ref|XP_002513464.1| serine/threonine protein kinase, putative [R... 56 4e-06 >ref|XP_006467202.1| PREDICTED: serine/threonine-protein kinase OXI1-like [Citrus sinensis] Length = 412 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 4/51 (7%) Frame = -1 Query: 377 EHVFFKGLRWDLLTDIECPPFVPSSVEVNIRKVVT----FDIREYFLKLRA 237 EHVFFKG+RWDLLTD+ PPF+PS E ++ + DIREYF LRA Sbjct: 341 EHVFFKGVRWDLLTDVLRPPFIPSREENDLTEKAMSGGGVDIREYFENLRA 391 >ref|XP_006446047.1| hypothetical protein CICLE_v10015414mg [Citrus clementina] gi|557548658|gb|ESR59287.1| hypothetical protein CICLE_v10015414mg [Citrus clementina] Length = 412 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 4/51 (7%) Frame = -1 Query: 377 EHVFFKGLRWDLLTDIECPPFVPSSVEVNIRKVVT----FDIREYFLKLRA 237 EHVFFKG+RWDLLTD+ PPF+PS E ++ + DIREYF LRA Sbjct: 341 EHVFFKGVRWDLLTDVLRPPFIPSREENDLTEKAMSGGGVDIREYFENLRA 391 >gb|EXB48381.1| Serine/threonine-protein kinase OXI1 [Morus notabilis] Length = 409 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -1 Query: 377 EHVFFKGLRWDLLTDIECPPFVPSSVEVNIRKVVT---FDIREYFLKLRA 237 EH FF+G+RWDLLT++ PPF+PS + ++ + T FDIR+YF KLR+ Sbjct: 344 EHDFFRGVRWDLLTEVSRPPFIPSRDDADLTERSTAAGFDIRDYFQKLRS 393 >ref|XP_002297784.2| hypothetical protein POPTR_0001s05570g [Populus trichocarpa] gi|550346581|gb|EEE82589.2| hypothetical protein POPTR_0001s05570g [Populus trichocarpa] Length = 396 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%) Frame = -1 Query: 377 EHVFFKGLRWDLLTDIECPPFVPSSVEVNIRKVVT---FDIREYFLKLRA 237 EHVFFKG+RWDLLT++ PPF+PS + + + T DIREYF LRA Sbjct: 327 EHVFFKGVRWDLLTEVLRPPFIPSRDDGELTERATAAGVDIREYFKDLRA 376 >ref|XP_002513464.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223547372|gb|EEF48867.1| serine/threonine protein kinase, putative [Ricinus communis] Length = 440 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 6/52 (11%) Frame = -1 Query: 377 EHVFFKGLRWDLLTDIECPPFVPSSVEVN-IRKVVT-----FDIREYFLKLR 240 EHVFFKG+RWDLLT++ PPF+P+ E N + + VT DIREYF LR Sbjct: 363 EHVFFKGVRWDLLTEVLRPPFIPARDETNSLTETVTSGSDGMDIREYFEDLR 414