BLASTX nr result
ID: Achyranthes23_contig00047882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00047882 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006410259.1| hypothetical protein EUTSA_v10016441mg [Eutr... 64 2e-08 ref|XP_002263743.1| PREDICTED: CDT1-like protein a, chloroplasti... 60 3e-07 emb|CBI37094.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_002532371.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 gb|EOX94483.1| CDT1 A, putative [Theobroma cacao] 57 3e-06 >ref|XP_006410259.1| hypothetical protein EUTSA_v10016441mg [Eutrema salsugineum] gi|557111428|gb|ESQ51712.1| hypothetical protein EUTSA_v10016441mg [Eutrema salsugineum] Length = 572 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/82 (34%), Positives = 56/82 (68%), Gaps = 3/82 (3%) Frame = -2 Query: 244 RLAKR---RSLKFDESSFDIEDQSGMDEEENILPGQDSAIAKDDVLAVLPENLLQSLMHK 74 +LA+R RSLKFD + D E DEE+ + ++ ++ D++L++LP+ L +++ + Sbjct: 392 KLARRSSLRSLKFDSHTEDEEANDVTDEEDTVQVPEEDVLSDDEILSILPDKLREAIKEQ 451 Query: 73 EKKMLEEQNPVVCEARKRQQMM 8 E+K +E+QNP + +A++R++M+ Sbjct: 452 ERKAIEDQNPAISQAKRRRKMI 473 >ref|XP_002263743.1| PREDICTED: CDT1-like protein a, chloroplastic-like [Vitis vinifera] Length = 646 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/84 (38%), Positives = 52/84 (61%) Frame = -2 Query: 253 LTNRLAKRRSLKFDESSFDIEDQSGMDEEENILPGQDSAIAKDDVLAVLPENLLQSLMHK 74 L R A+ RSLKFD E + ++E+ S +D+L +LPENLL+S+ K Sbjct: 482 LVRRPARSRSLKFDTPVKGAEIKEEVNEK-------GSLSVDNDILDILPENLLESIREK 534 Query: 73 EKKMLEEQNPVVCEARKRQQMMGG 2 E+K +EEQ+P + +A++R++M+ G Sbjct: 535 ERKAIEEQDPAISQAKRRREMIVG 558 >emb|CBI37094.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/84 (38%), Positives = 52/84 (61%) Frame = -2 Query: 253 LTNRLAKRRSLKFDESSFDIEDQSGMDEEENILPGQDSAIAKDDVLAVLPENLLQSLMHK 74 L R A+ RSLKFD E + ++E+ S +D+L +LPENLL+S+ K Sbjct: 454 LVRRPARSRSLKFDTPVKGAEIKEEVNEK-------GSLSVDNDILDILPENLLESIREK 506 Query: 73 EKKMLEEQNPVVCEARKRQQMMGG 2 E+K +EEQ+P + +A++R++M+ G Sbjct: 507 ERKAIEEQDPAISQAKRRREMIVG 530 >ref|XP_002532371.1| conserved hypothetical protein [Ricinus communis] gi|223527927|gb|EEF30014.1| conserved hypothetical protein [Ricinus communis] Length = 578 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/90 (36%), Positives = 56/90 (62%), Gaps = 4/90 (4%) Frame = -2 Query: 265 DTCVLTNRLAKR----RSLKFDESSFDIEDQSGMDEEENILPGQDSAIAKDDVLAVLPEN 98 D+ L N+L +R RSLKF+ ++ED+ + ++ G D D+L +LPE+ Sbjct: 405 DSTSLANKLVRRPVRTRSLKFESPLKNVEDE--LIDDSGDASGDDDG----DILKILPES 458 Query: 97 LLQSLMHKEKKMLEEQNPVVCEARKRQQMM 8 LLQS+ KE+K EE++P + +A++R+QM+ Sbjct: 459 LLQSIREKERKAQEERDPAISQAKRRRQMI 488 >gb|EOX94483.1| CDT1 A, putative [Theobroma cacao] Length = 616 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/82 (36%), Positives = 53/82 (64%) Frame = -2 Query: 253 LTNRLAKRRSLKFDESSFDIEDQSGMDEEENILPGQDSAIAKDDVLAVLPENLLQSLMHK 74 L R + RSLKFD +++++ +DE + + G+ +D L++LPE+LL S+ K Sbjct: 449 LVRRPPRTRSLKFDTP---VKEENIVDEVQE-MAGKPLDDDEDSALSILPESLLHSIREK 504 Query: 73 EKKMLEEQNPVVCEARKRQQMM 8 E+K +EE++P + A++RQQM+ Sbjct: 505 ERKAIEERDPAISRAKRRQQMI 526